Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2466883..2467718 | Replicon | chromosome |
Accession | NZ_CP101666 | ||
Organism | Escherichia coli strain M171-1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NO473_RS12105 | Protein ID | WP_057109034.1 |
Coordinates | 2467341..2467718 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1E5MC43 |
Locus tag | NO473_RS12100 | Protein ID | WP_063112944.1 |
Coordinates | 2466883..2467251 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO473_RS12060 (2462060) | 2462060..2462944 | + | 885 | WP_023563932.1 | 50S ribosome-binding GTPase | - |
NO473_RS12065 (2463063) | 2463063..2463740 | + | 678 | WP_063091580.1 | hypothetical protein | - |
NO473_RS12070 (2463746) | 2463746..2463898 | + | 153 | WP_001696589.1 | DUF905 family protein | - |
NO473_RS12075 (2463999) | 2463999..2464817 | + | 819 | WP_096211214.1 | DUF932 domain-containing protein | - |
NO473_RS12080 (2464909) | 2464909..2465394 | + | 486 | WP_000213716.1 | antirestriction protein | - |
NO473_RS12085 (2465410) | 2465410..2465886 | + | 477 | WP_001186780.1 | RadC family protein | - |
NO473_RS12090 (2465949) | 2465949..2466170 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
NO473_RS12095 (2466189) | 2466189..2466833 | + | 645 | WP_045146861.1 | hypothetical protein | - |
NO473_RS12100 (2466883) | 2466883..2467251 | + | 369 | WP_063112944.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NO473_RS12105 (2467341) | 2467341..2467718 | + | 378 | WP_057109034.1 | TA system toxin CbtA family protein | Toxin |
NO473_RS12110 (2467715) | 2467715..2467864 | + | 150 | Protein_2363 | DUF5983 family protein | - |
NO473_RS12115 (2467940) | 2467940..2468137 | + | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
NO473_RS12120 (2468222) | 2468222..2469064 | + | 843 | WP_001529559.1 | DUF4942 domain-containing protein | - |
NO473_RS12125 (2469813) | 2469813..2471351 | + | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2455622..2479164 | 23542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13934.86 Da Isoelectric Point: 6.8517
>T252467 WP_057109034.1 NZ_CP101666:2467341-2467718 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13724.52 Da Isoelectric Point: 6.8270
>AT252467 WP_063112944.1 NZ_CP101666:2466883-2467251 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|