Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2435877..2436475 Replicon chromosome
Accession NZ_CP101666
Organism Escherichia coli strain M171-1

Toxin (Protein)


Gene name doc Uniprot ID A0A8T6PRV3
Locus tag NO473_RS11955 Protein ID WP_053291281.1
Coordinates 2435877..2436254 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID L4J1C0
Locus tag NO473_RS11960 Protein ID WP_001603498.1
Coordinates 2436254..2436475 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO473_RS11925 (2431101) 2431101..2431439 + 339 WP_000883400.1 divalent cation tolerance protein CutA -
NO473_RS11930 (2431415) 2431415..2433112 + 1698 WP_072643567.1 protein-disulfide reductase DsbD -
NO473_RS11935 (2433149) 2433149..2433724 + 576 WP_001188520.1 transcriptional regulator -
NO473_RS11945 (2434104) 2434104..2435366 + 1263 WP_096263470.1 integrase arm-type DNA-binding domain-containing protein -
NO473_RS11950 (2435552) 2435552..2435767 + 216 Protein_2331 transposase -
NO473_RS11955 (2435877) 2435877..2436254 - 378 WP_053291281.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NO473_RS11960 (2436254) 2436254..2436475 - 222 WP_001603498.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NO473_RS11965 (2436660) 2436660..2436968 - 309 Protein_2334 fimbrial protein -
NO473_RS11975 (2437726) 2437726..2437866 - 141 Protein_2336 DUF2254 domain-containing protein -
NO473_RS11980 (2437929) 2437929..2439926 - 1998 Protein_2337 choline BCCT transporter BetT -
NO473_RS11985 (2440209) 2440209..2441207 - 999 WP_088474911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2433149..2437670 4521
- inside IScluster/Tn - - 2435552..2437670 2118


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13487.28 Da        Isoelectric Point: 6.2257

>T252466 WP_053291281.1 NZ_CP101666:c2436254-2435877 [Escherichia coli]
MRHISPEELIAIHDANISRYGGLPGMPDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8190.24 Da        Isoelectric Point: 6.3159

>AT252466 WP_001603498.1 NZ_CP101666:c2436475-2436254 [Escherichia coli]
MQSINFRTARSNLTEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDTTNKKLVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L4J1C0

References