Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2435877..2436475 | Replicon | chromosome |
| Accession | NZ_CP101666 | ||
| Organism | Escherichia coli strain M171-1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A8T6PRV3 |
| Locus tag | NO473_RS11955 | Protein ID | WP_053291281.1 |
| Coordinates | 2435877..2436254 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | L4J1C0 |
| Locus tag | NO473_RS11960 | Protein ID | WP_001603498.1 |
| Coordinates | 2436254..2436475 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO473_RS11925 (2431101) | 2431101..2431439 | + | 339 | WP_000883400.1 | divalent cation tolerance protein CutA | - |
| NO473_RS11930 (2431415) | 2431415..2433112 | + | 1698 | WP_072643567.1 | protein-disulfide reductase DsbD | - |
| NO473_RS11935 (2433149) | 2433149..2433724 | + | 576 | WP_001188520.1 | transcriptional regulator | - |
| NO473_RS11945 (2434104) | 2434104..2435366 | + | 1263 | WP_096263470.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NO473_RS11950 (2435552) | 2435552..2435767 | + | 216 | Protein_2331 | transposase | - |
| NO473_RS11955 (2435877) | 2435877..2436254 | - | 378 | WP_053291281.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NO473_RS11960 (2436254) | 2436254..2436475 | - | 222 | WP_001603498.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NO473_RS11965 (2436660) | 2436660..2436968 | - | 309 | Protein_2334 | fimbrial protein | - |
| NO473_RS11975 (2437726) | 2437726..2437866 | - | 141 | Protein_2336 | DUF2254 domain-containing protein | - |
| NO473_RS11980 (2437929) | 2437929..2439926 | - | 1998 | Protein_2337 | choline BCCT transporter BetT | - |
| NO473_RS11985 (2440209) | 2440209..2441207 | - | 999 | WP_088474911.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2433149..2437670 | 4521 | |
| - | inside | IScluster/Tn | - | - | 2435552..2437670 | 2118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13487.28 Da Isoelectric Point: 6.2257
>T252466 WP_053291281.1 NZ_CP101666:c2436254-2435877 [Escherichia coli]
MRHISPEELIAIHDANISRYGGLPGMPDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
MRHISPEELIAIHDANISRYGGLPGMPDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|