Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1768387..1769005 | Replicon | chromosome |
Accession | NZ_CP101666 | ||
Organism | Escherichia coli strain M171-1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NO473_RS08685 | Protein ID | WP_001291435.1 |
Coordinates | 1768787..1769005 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NO473_RS08680 | Protein ID | WP_000344800.1 |
Coordinates | 1768387..1768761 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO473_RS08670 (1763476) | 1763476..1764669 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NO473_RS08675 (1764692) | 1764692..1767841 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NO473_RS08680 (1768387) | 1768387..1768761 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NO473_RS08685 (1768787) | 1768787..1769005 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NO473_RS08690 (1769177) | 1769177..1769728 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NO473_RS08695 (1769844) | 1769844..1770314 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NO473_RS08700 (1770478) | 1770478..1772028 | + | 1551 | WP_072643403.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NO473_RS08705 (1772070) | 1772070..1772423 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NO473_RS08715 (1772802) | 1772802..1773113 | + | 312 | WP_165369371.1 | MGMT family protein | - |
NO473_RS08720 (1773144) | 1773144..1773716 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252463 WP_001291435.1 NZ_CP101666:1768787-1769005 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT252463 WP_000344800.1 NZ_CP101666:1768387-1768761 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |