Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 742727..743365 | Replicon | chromosome |
| Accession | NZ_CP101666 | ||
| Organism | Escherichia coli strain M171-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NO473_RS03600 | Protein ID | WP_000813794.1 |
| Coordinates | 743189..743365 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NO473_RS03595 | Protein ID | WP_001270286.1 |
| Coordinates | 742727..743143 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO473_RS03575 (737879) | 737879..738820 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NO473_RS03580 (738821) | 738821..739834 | - | 1014 | WP_072643648.1 | ABC transporter ATP-binding protein | - |
| NO473_RS03585 (739852) | 739852..740997 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NO473_RS03590 (741242) | 741242..742648 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
| NO473_RS03595 (742727) | 742727..743143 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NO473_RS03600 (743189) | 743189..743365 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NO473_RS03605 (743587) | 743587..743817 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NO473_RS03610 (743909) | 743909..745870 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NO473_RS03615 (745943) | 745943..746479 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| NO473_RS03620 (746571) | 746571..747746 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 747786..749051 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T252462 WP_000813794.1 NZ_CP101666:c743365-743189 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252462 WP_001270286.1 NZ_CP101666:c743143-742727 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|