Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1220065..1220982 | Replicon | chromosome |
Accession | NZ_CP101661 | ||
Organism | Bacillus amyloliquefaciens strain B408 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NO220_RS06395 | Protein ID | WP_025851786.1 |
Coordinates | 1220236..1220982 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NO220_RS06390 | Protein ID | WP_003154807.1 |
Coordinates | 1220065..1220235 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO220_RS06350 (NO220_06350) | 1215296..1216918 | + | 1623 | WP_003154821.1 | pyocin knob domain-containing protein | - |
NO220_RS06355 (NO220_06355) | 1216931..1217302 | + | 372 | WP_014304856.1 | XkdW family protein | - |
NO220_RS06360 (NO220_06360) | 1217308..1217505 | + | 198 | WP_003154819.1 | XkdX family protein | - |
NO220_RS06365 (NO220_06365) | 1217562..1218323 | + | 762 | WP_043867020.1 | hypothetical protein | - |
NO220_RS06370 (NO220_06370) | 1218375..1218638 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NO220_RS06375 (NO220_06375) | 1218652..1218915 | + | 264 | WP_003154813.1 | phage holin | - |
NO220_RS06380 (NO220_06380) | 1218929..1219807 | + | 879 | WP_025851788.1 | N-acetylmuramoyl-L-alanine amidase | - |
NO220_RS06385 (NO220_06385) | 1219843..1219968 | - | 126 | WP_003154809.1 | hypothetical protein | - |
NO220_RS06390 (NO220_06390) | 1220065..1220235 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NO220_RS06395 (NO220_06395) | 1220236..1220982 | - | 747 | WP_025851786.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NO220_RS06400 (NO220_06400) | 1221087..1222085 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NO220_RS06405 (NO220_06405) | 1222098..1222715 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NO220_RS06410 (NO220_06410) | 1223001..1224317 | - | 1317 | WP_003154801.1 | amino acid permease | - |
NO220_RS06415 (NO220_06415) | 1224640..1225590 | + | 951 | WP_043867021.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.53 Da Isoelectric Point: 4.7003
>T252455 WP_025851786.1 NZ_CP101661:c1220982-1220236 [Bacillus amyloliquefaciens]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|