Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 466452..467089 | Replicon | chromosome |
Accession | NZ_CP101661 | ||
Organism | Bacillus amyloliquefaciens strain B408 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NO220_RS02405 | Protein ID | WP_003156187.1 |
Coordinates | 466739..467089 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NO220_RS02400 | Protein ID | WP_003156188.1 |
Coordinates | 466452..466733 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO220_RS02380 (NO220_02380) | 462817..463416 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NO220_RS02385 (NO220_02385) | 463509..463874 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
NO220_RS02390 (NO220_02390) | 464039..465046 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
NO220_RS02395 (NO220_02395) | 465163..466332 | + | 1170 | WP_003156189.1 | alanine racemase | - |
NO220_RS02400 (NO220_02400) | 466452..466733 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NO220_RS02405 (NO220_02405) | 466739..467089 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NO220_RS02410 (NO220_02410) | 467207..468028 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NO220_RS02415 (NO220_02415) | 468033..468398 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NO220_RS02420 (NO220_02420) | 468401..468802 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NO220_RS02425 (NO220_02425) | 468814..469821 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
NO220_RS02430 (NO220_02430) | 469885..470214 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NO220_RS02435 (NO220_02435) | 470211..470693 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
NO220_RS02440 (NO220_02440) | 470659..471447 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NO220_RS02445 (NO220_02445) | 471447..472049 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T252454 WP_003156187.1 NZ_CP101661:466739-467089 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|