Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5718578..5719186 | Replicon | chromosome |
Accession | NZ_CP101656 | ||
Organism | Pseudomonas aeruginosa strain L1a |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | MBA02_RS26435 | Protein ID | WP_003114156.1 |
Coordinates | 5718578..5718925 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | MBA02_RS26440 | Protein ID | WP_003114155.1 |
Coordinates | 5718935..5719186 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBA02_RS26405 (MBA02_026405) | 5713937..5714209 | + | 273 | WP_010895521.1 | cysteine-rich CWC family protein | - |
MBA02_RS26410 (MBA02_026410) | 5714209..5714901 | + | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
MBA02_RS26415 (MBA02_026415) | 5715037..5716080 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
MBA02_RS26420 (MBA02_026420) | 5716160..5716897 | + | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
MBA02_RS26425 (MBA02_026425) | 5717349..5718251 | + | 903 | WP_003114157.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
MBA02_RS26435 (MBA02_026435) | 5718578..5718925 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MBA02_RS26440 (MBA02_026440) | 5718935..5719186 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MBA02_RS26445 (MBA02_026445) | 5719400..5720383 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
MBA02_RS26450 (MBA02_026450) | 5720383..5721675 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
MBA02_RS26455 (MBA02_026455) | 5721905..5723179 | - | 1275 | WP_010895520.1 | zonular occludens toxin family protein | - |
MBA02_RS26460 (MBA02_026460) | 5723183..5723539 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5718578..5746954 | 28376 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T252452 WP_003114156.1 NZ_CP101656:c5718925-5718578 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |