Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 1143876..1144381 | Replicon | chromosome |
Accession | NZ_CP101656 | ||
Organism | Pseudomonas aeruginosa strain L1a |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | MBA02_RS05225 | Protein ID | WP_003083773.1 |
Coordinates | 1143876..1144157 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | MBA02_RS05230 | Protein ID | WP_003112628.1 |
Coordinates | 1144154..1144381 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBA02_RS05200 (MBA02_005200) | 1139127..1140476 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
MBA02_RS05205 (MBA02_005205) | 1140525..1141211 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
MBA02_RS05210 (MBA02_005210) | 1141312..1142046 | + | 735 | WP_003115036.1 | GntR family transcriptional regulator | - |
MBA02_RS05215 (MBA02_005215) | 1142226..1142636 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
MBA02_RS05220 (MBA02_005220) | 1142668..1143576 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
MBA02_RS05225 (MBA02_005225) | 1143876..1144157 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
MBA02_RS05230 (MBA02_005230) | 1144154..1144381 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
MBA02_RS05235 (MBA02_005235) | 1144557..1145177 | - | 621 | WP_003101226.1 | hypothetical protein | - |
MBA02_RS05240 (MBA02_005240) | 1145278..1145778 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
MBA02_RS05245 (MBA02_005245) | 1145851..1146192 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
MBA02_RS05250 (MBA02_005250) | 1146274..1147701 | - | 1428 | WP_003083784.1 | GABA permease | - |
MBA02_RS05255 (MBA02_005255) | 1147870..1149363 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T252447 WP_003083773.1 NZ_CP101656:c1144157-1143876 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|