Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 3154050..3154618 | Replicon | chromosome |
| Accession | NZ_CP101651 | ||
| Organism | Streptomyces sp. CRCS-T-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NNW99_RS13890 | Protein ID | WP_215119363.1 |
| Coordinates | 3154337..3154618 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NNW99_RS13885 | Protein ID | WP_251057782.1 |
| Coordinates | 3154050..3154331 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNW99_RS13860 (NNW99_13865) | 3149343..3150116 | + | 774 | WP_215119357.1 | SDR family oxidoreductase | - |
| NNW99_RS13865 (NNW99_13870) | 3150236..3150943 | + | 708 | WP_215119358.1 | ester cyclase | - |
| NNW99_RS13870 (NNW99_13875) | 3151764..3152057 | - | 294 | WP_215119360.1 | hypothetical protein | - |
| NNW99_RS13875 (NNW99_13880) | 3152393..3153283 | + | 891 | WP_215119361.1 | hypothetical protein | - |
| NNW99_RS13880 (NNW99_13885) | 3153367..3154002 | + | 636 | WP_251057781.1 | hypothetical protein | - |
| NNW99_RS13885 (NNW99_13890) | 3154050..3154331 | + | 282 | WP_251057782.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NNW99_RS13890 (NNW99_13895) | 3154337..3154618 | + | 282 | WP_215119363.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NNW99_RS13895 (NNW99_13900) | 3154775..3155278 | + | 504 | Protein_2761 | DUF2791 family P-loop domain-containing protein | - |
| NNW99_RS13900 (NNW99_13905) | 3155292..3156335 | - | 1044 | WP_251057783.1 | hypothetical protein | - |
| NNW99_RS13905 (NNW99_13910) | 3156476..3158101 | - | 1626 | WP_215119365.1 | chaperonin GroEL | - |
| NNW99_RS13910 (NNW99_13915) | 3158223..3158531 | - | 309 | WP_003974211.1 | co-chaperone GroES | - |
| NNW99_RS13915 (NNW99_13920) | 3158877..3159608 | - | 732 | WP_251057784.1 | polysaccharide deacetylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10885.63 Da Isoelectric Point: 10.8148
>T252446 WP_215119363.1 NZ_CP101651:3154337-3154618 [Streptomyces sp. CRCS-T-1]
MGYVTRFTPHAQRDMLKIPRPDALRILYRLTELQKAMDAGETAAFDVKALRGHNARWRLRVGDYRVVYTVEDGRVVVWVL
TVGNRREVYRQVP
MGYVTRFTPHAQRDMLKIPRPDALRILYRLTELQKAMDAGETAAFDVKALRGHNARWRLRVGDYRVVYTVEDGRVVVWVL
TVGNRREVYRQVP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|