Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 3154056..3154624 | Replicon | chromosome |
Accession | NZ_CP101649 | ||
Organism | Streptomyces sp. CRLD-Y-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NNW98_RS13895 | Protein ID | WP_215119363.1 |
Coordinates | 3154343..3154624 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NNW98_RS13890 | Protein ID | WP_251057782.1 |
Coordinates | 3154056..3154337 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNW98_RS13865 (NNW98_13870) | 3149349..3150122 | + | 774 | WP_215119357.1 | SDR family oxidoreductase | - |
NNW98_RS13870 (NNW98_13875) | 3150242..3150949 | + | 708 | WP_215119358.1 | ester cyclase | - |
NNW98_RS13875 (NNW98_13880) | 3151770..3152063 | - | 294 | WP_215119360.1 | hypothetical protein | - |
NNW98_RS13880 (NNW98_13885) | 3152399..3153289 | + | 891 | WP_215119361.1 | hypothetical protein | - |
NNW98_RS13885 (NNW98_13890) | 3153373..3154008 | + | 636 | WP_251057781.1 | hypothetical protein | - |
NNW98_RS13890 (NNW98_13895) | 3154056..3154337 | + | 282 | WP_251057782.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NNW98_RS13895 (NNW98_13900) | 3154343..3154624 | + | 282 | WP_215119363.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NNW98_RS13900 (NNW98_13905) | 3154781..3155284 | + | 504 | Protein_2762 | DUF2791 family P-loop domain-containing protein | - |
NNW98_RS13905 (NNW98_13910) | 3155298..3156341 | - | 1044 | WP_251057783.1 | hypothetical protein | - |
NNW98_RS13910 (NNW98_13915) | 3156482..3158107 | - | 1626 | WP_215119365.1 | chaperonin GroEL | - |
NNW98_RS13915 (NNW98_13920) | 3158229..3158537 | - | 309 | WP_003974211.1 | co-chaperone GroES | - |
NNW98_RS13920 (NNW98_13925) | 3158883..3159614 | - | 732 | WP_251057784.1 | polysaccharide deacetylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10885.63 Da Isoelectric Point: 10.8148
>T252445 WP_215119363.1 NZ_CP101649:3154343-3154624 [Streptomyces sp. CRLD-Y-1]
MGYVTRFTPHAQRDMLKIPRPDALRILYRLTELQKAMDAGETAAFDVKALRGHNARWRLRVGDYRVVYTVEDGRVVVWVL
TVGNRREVYRQVP
MGYVTRFTPHAQRDMLKIPRPDALRILYRLTELQKAMDAGETAAFDVKALRGHNARWRLRVGDYRVVYTVEDGRVVVWVL
TVGNRREVYRQVP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|