Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4508584..4509227 | Replicon | chromosome |
Accession | NZ_CP101648 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain BCID6 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | NOQ95_RS21805 | Protein ID | WP_000048134.1 |
Coordinates | 4508811..4509227 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | NOQ95_RS21800 | Protein ID | WP_001261294.1 |
Coordinates | 4508584..4508814 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ95_RS21790 (4505597) | 4505597..4507735 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NOQ95_RS21795 (4507952) | 4507952..4508416 | + | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NOQ95_RS21800 (4508584) | 4508584..4508814 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NOQ95_RS21805 (4508811) | 4508811..4509227 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NOQ95_RS21810 (4509288) | 4509288..4511201 | - | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
NOQ95_RS21815 (4511218) | 4511218..4511958 | - | 741 | WP_000779255.1 | KDGP aldolase family protein | - |
NOQ95_RS21820 (4511955) | 4511955..4513073 | - | 1119 | WP_023224150.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NOQ95_RS21825 (4513057) | 4513057..4514190 | - | 1134 | WP_023224151.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T252443 WP_000048134.1 NZ_CP101648:4508811-4509227 [Salmonella enterica subsp. enterica serovar Kentucky]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |