Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3775465..3776085 | Replicon | chromosome |
Accession | NZ_CP101648 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain BCID6 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NOQ95_RS18445 | Protein ID | WP_001280991.1 |
Coordinates | 3775867..3776085 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NOQ95_RS18440 | Protein ID | WP_000344807.1 |
Coordinates | 3775465..3775839 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ95_RS18430 (3770604) | 3770604..3771797 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NOQ95_RS18435 (3771820) | 3771820..3774969 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NOQ95_RS18440 (3775465) | 3775465..3775839 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NOQ95_RS18445 (3775867) | 3775867..3776085 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NOQ95_RS18450 (3776264) | 3776264..3776815 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NOQ95_RS18455 (3776933) | 3776933..3777403 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NOQ95_RS18460 (3777459) | 3777459..3777599 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NOQ95_RS18465 (3777605) | 3777605..3777865 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NOQ95_RS18470 (3778090) | 3778090..3779640 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NOQ95_RS18480 (3779871) | 3779871..3780260 | + | 390 | WP_023224410.1 | MGMT family protein | - |
NOQ95_RS18485 (3780293) | 3780293..3780862 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252440 WP_001280991.1 NZ_CP101648:3775867-3776085 [Salmonella enterica subsp. enterica serovar Kentucky]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252440 WP_000344807.1 NZ_CP101648:3775465-3775839 [Salmonella enterica subsp. enterica serovar Kentucky]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|