Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2788894..2789416 | Replicon | chromosome |
| Accession | NZ_CP101648 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain BCID6 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | NOQ95_RS13565 | Protein ID | WP_000221345.1 |
| Coordinates | 2789132..2789416 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NOQ95_RS13560 | Protein ID | WP_000885424.1 |
| Coordinates | 2788894..2789142 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOQ95_RS13530 (2784420) | 2784420..2785328 | - | 909 | WP_052939372.1 | LysR family transcriptional regulator | - |
| NOQ95_RS13535 (2785730) | 2785730..2785918 | + | 189 | WP_001276021.1 | DUF29 family protein | - |
| NOQ95_RS13540 (2786284) | 2786284..2787023 | + | 740 | Protein_2626 | hypothetical protein | - |
| NOQ95_RS13545 (2787025) | 2787025..2787933 | - | 909 | WP_077906523.1 | hypothetical protein | - |
| NOQ95_RS13550 (2788206) | 2788206..2788537 | - | 332 | Protein_2628 | DUF1493 family protein | - |
| NOQ95_RS13555 (2788623) | 2788623..2788742 | - | 120 | Protein_2629 | type II and III secretion system | - |
| NOQ95_RS13560 (2788894) | 2788894..2789142 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NOQ95_RS13565 (2789132) | 2789132..2789416 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NOQ95_RS13570 (2789587) | 2789587..2789976 | + | 390 | WP_000194089.1 | RidA family protein | - |
| NOQ95_RS13575 (2790028) | 2790028..2791107 | - | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NOQ95_RS13580 (2791300) | 2791300..2791788 | - | 489 | WP_023223899.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NOQ95_RS13585 (2791833) | 2791833..2792696 | + | 864 | Protein_2635 | FAD-dependent monooxygenase | - |
| NOQ95_RS13590 (2792680) | 2792680..2793246 | + | 567 | Protein_2636 | MFS transporter | - |
| NOQ95_RS13595 (2793221) | 2793221..2794246 | + | 1026 | WP_000864928.1 | zinc-binding alcohol dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2781548..2792747 | 11199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T252439 WP_000221345.1 NZ_CP101648:2789132-2789416 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |