Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1394119..1394933 | Replicon | chromosome |
Accession | NZ_CP101648 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain BCID6 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3G3DUX8 |
Locus tag | NOQ95_RS06730 | Protein ID | WP_000971653.1 |
Coordinates | 1394119..1394646 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NOQ95_RS06735 | Protein ID | WP_000855694.1 |
Coordinates | 1394643..1394933 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ95_RS06700 (1390493) | 1390493..1390891 | + | 399 | Protein_1292 | cytoplasmic protein | - |
NOQ95_RS06705 (1391102) | 1391102..1391320 | + | 219 | Protein_1293 | hypothetical protein | - |
NOQ95_RS06710 (1391477) | 1391477..1392145 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NOQ95_RS06715 (1392172) | 1392172..1392666 | + | 495 | WP_000424946.1 | hypothetical protein | - |
NOQ95_RS06720 (1392838) | 1392838..1393494 | - | 657 | WP_023225036.1 | protein-serine/threonine phosphatase | - |
NOQ95_RS06725 (1393844) | 1393844..1394046 | + | 203 | Protein_1297 | IS5/IS1182 family transposase | - |
NOQ95_RS06730 (1394119) | 1394119..1394646 | - | 528 | WP_000971653.1 | GNAT family N-acetyltransferase | Toxin |
NOQ95_RS06735 (1394643) | 1394643..1394933 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NOQ95_RS06740 (1395204) | 1395204..1395404 | - | 201 | Protein_1300 | transposase | - |
NOQ95_RS06745 (1395645) | 1395645..1395971 | + | 327 | WP_000393295.1 | hypothetical protein | - |
NOQ95_RS06750 (1396244) | 1396244..1396592 | - | 349 | Protein_1302 | DUF1493 family protein | - |
NOQ95_RS06755 (1396577) | 1396577..1397026 | - | 450 | WP_023225038.1 | hypothetical protein | - |
NOQ95_RS06760 (1397458) | 1397458..1397901 | - | 444 | WP_023225039.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NOQ95_RS06765 (1398359) | 1398359..1399009 | + | 651 | WP_072203970.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1392838..1404322 | 11484 | |
- | inside | IScluster/Tn | - | - | 1393870..1395404 | 1534 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19043.87 Da Isoelectric Point: 9.7032
>T252434 WP_000971653.1 NZ_CP101648:c1394646-1394119 [Salmonella enterica subsp. enterica serovar Kentucky]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT252434 WP_000855694.1 NZ_CP101648:c1394933-1394643 [Salmonella enterica subsp. enterica serovar Kentucky]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3DUX8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |