Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1225946..1226606 | Replicon | chromosome |
Accession | NZ_CP101648 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain BCID6 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NOQ95_RS05960 | Protein ID | WP_000244756.1 |
Coordinates | 1226193..1226606 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NOQ95_RS05955 | Protein ID | WP_000351186.1 |
Coordinates | 1225946..1226212 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ95_RS05935 (1221875) | 1221875..1223308 | - | 1434 | WP_001230143.1 | 6-phospho-beta-glucosidase BglA | - |
NOQ95_RS05940 (1223466) | 1223466..1223777 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
NOQ95_RS05945 (1223941) | 1223941..1224600 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
NOQ95_RS05950 (1224716) | 1224716..1225696 | - | 981 | WP_000874178.1 | tRNA-modifying protein YgfZ | - |
NOQ95_RS05955 (1225946) | 1225946..1226212 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NOQ95_RS05960 (1226193) | 1226193..1226606 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
NOQ95_RS05965 (1226659) | 1226659..1227180 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
NOQ95_RS05970 (1227293) | 1227293..1228189 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NOQ95_RS05975 (1228213) | 1228213..1228926 | + | 714 | WP_023223829.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NOQ95_RS05980 (1228932) | 1228932..1230665 | + | 1734 | WP_023223830.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T252433 WP_000244756.1 NZ_CP101648:1226193-1226606 [Salmonella enterica subsp. enterica serovar Kentucky]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT252433 WP_000351186.1 NZ_CP101648:1225946-1226212 [Salmonella enterica subsp. enterica serovar Kentucky]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |