Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 691472..692263 | Replicon | chromosome |
Accession | NZ_CP101648 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain BCID6 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | C0Q119 |
Locus tag | NOQ95_RS03275 | Protein ID | WP_000369560.1 |
Coordinates | 691745..692263 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q57IR1 |
Locus tag | NOQ95_RS03270 | Protein ID | WP_001275017.1 |
Coordinates | 691472..691741 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ95_RS03250 (687053) | 687053..687721 | + | 669 | WP_000617729.1 | cell division ATP-binding protein FtsE | - |
NOQ95_RS03255 (687714) | 687714..688769 | + | 1056 | WP_001081707.1 | permease-like cell division protein FtsX | - |
NOQ95_RS03260 (689015) | 689015..689869 | + | 855 | WP_000159621.1 | RNA polymerase sigma factor RpoH | - |
NOQ95_RS03265 (690191) | 690191..691294 | + | 1104 | WP_001533929.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NOQ95_RS03270 (691472) | 691472..691741 | + | 270 | WP_001275017.1 | DUF1778 domain-containing protein | Antitoxin |
NOQ95_RS03275 (691745) | 691745..692263 | + | 519 | WP_000369560.1 | GNAT family N-acetyltransferase | Toxin |
NOQ95_RS03280 (692260) | 692260..692643 | - | 384 | WP_000778873.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NOQ95_RS03285 (693065) | 693065..694174 | + | 1110 | WP_023224165.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NOQ95_RS03290 (694234) | 694234..695160 | + | 927 | WP_000003005.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NOQ95_RS03295 (695157) | 695157..696434 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
NOQ95_RS03300 (696431) | 696431..697198 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19414.16 Da Isoelectric Point: 8.9619
>T252432 WP_000369560.1 NZ_CP101648:691745-692263 [Salmonella enterica subsp. enterica serovar Kentucky]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
Download Length: 519 bp
Antitoxin
Download Length: 90 a.a. Molecular weight: 10086.53 Da Isoelectric Point: 7.2056
>AT252432 WP_001275017.1 NZ_CP101648:691472-691741 [Salmonella enterica subsp. enterica serovar Kentucky]
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME
Download Length: 270 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5BA59 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I8URP5 |