Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4646752..4647533 | Replicon | chromosome |
Accession | NZ_CP101647 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain KCID6 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | NOQ94_RS22540 | Protein ID | WP_000625911.1 |
Coordinates | 4646752..4647243 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | NOQ94_RS22545 | Protein ID | WP_001271379.1 |
Coordinates | 4647240..4647533 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ94_RS22515 (4641888) | 4641888..4644326 | - | 2439 | WP_023224120.1 | F4 (K88) fimbrial usher FaeD | - |
NOQ94_RS22520 (4644336) | 4644336..4644875 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
NOQ94_RS22525 (4644910) | 4644910..4645194 | - | 285 | WP_192917775.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
NOQ94_RS22530 (4645787) | 4645787..4646014 | + | 228 | WP_001112992.1 | hypothetical protein | - |
NOQ94_RS22535 (4646289) | 4646289..4646537 | - | 249 | Protein_4383 | IS481 family transposase | - |
NOQ94_RS22540 (4646752) | 4646752..4647243 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
NOQ94_RS22545 (4647240) | 4647240..4647533 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
NOQ94_RS22550 (4647851) | 4647851..4648072 | + | 222 | WP_052939504.1 | hypothetical protein | - |
NOQ94_RS22555 (4648338) | 4648338..4649213 | + | 876 | WP_023205266.1 | AraC family transcriptional regulator | - |
NOQ94_RS22560 (4649210) | 4649210..4649497 | + | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
NOQ94_RS22565 (4649490) | 4649490..4649672 | - | 183 | WP_072106065.1 | ATP-binding cassette domain-containing protein | - |
NOQ94_RS22570 (4649692) | 4649692..4649791 | + | 100 | Protein_4390 | hypothetical protein | - |
NOQ94_RS22575 (4649839) | 4649839..4650033 | + | 195 | WP_223163373.1 | hypothetical protein | - |
NOQ94_RS22580 (4650328) | 4650328..4651233 | - | 906 | WP_001268192.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4633729..4649672 | 15943 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T252428 WP_000625911.1 NZ_CP101647:c4647243-4646752 [Salmonella enterica subsp. enterica serovar Kentucky]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT252428 WP_001271379.1 NZ_CP101647:c4647533-4647240 [Salmonella enterica subsp. enterica serovar Kentucky]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |