Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3775445..3776065 | Replicon | chromosome |
Accession | NZ_CP101647 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain KCID6 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NOQ94_RS18450 | Protein ID | WP_001280991.1 |
Coordinates | 3775847..3776065 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NOQ94_RS18445 | Protein ID | WP_000344807.1 |
Coordinates | 3775445..3775819 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ94_RS18435 (3770583) | 3770583..3771776 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NOQ94_RS18440 (3771799) | 3771799..3774948 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NOQ94_RS18445 (3775445) | 3775445..3775819 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NOQ94_RS18450 (3775847) | 3775847..3776065 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NOQ94_RS18455 (3776244) | 3776244..3776795 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NOQ94_RS18460 (3776913) | 3776913..3777383 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NOQ94_RS18465 (3777439) | 3777439..3777579 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NOQ94_RS18470 (3777585) | 3777585..3777845 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NOQ94_RS18475 (3778070) | 3778070..3779620 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NOQ94_RS18485 (3779851) | 3779851..3780240 | + | 390 | WP_023224410.1 | MGMT family protein | - |
NOQ94_RS18490 (3780273) | 3780273..3780842 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252424 WP_001280991.1 NZ_CP101647:3775847-3776065 [Salmonella enterica subsp. enterica serovar Kentucky]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252424 WP_000344807.1 NZ_CP101647:3775445-3775819 [Salmonella enterica subsp. enterica serovar Kentucky]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|