Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2788895..2789417 | Replicon | chromosome |
Accession | NZ_CP101647 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain KCID6 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NOQ94_RS13570 | Protein ID | WP_000221345.1 |
Coordinates | 2789133..2789417 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NOQ94_RS13565 | Protein ID | WP_000885424.1 |
Coordinates | 2788895..2789143 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ94_RS13535 (2784421) | 2784421..2785329 | - | 909 | WP_052939372.1 | LysR family transcriptional regulator | - |
NOQ94_RS13540 (2785731) | 2785731..2785919 | + | 189 | WP_001276021.1 | DUF29 family protein | - |
NOQ94_RS13545 (2786285) | 2786285..2787024 | + | 740 | Protein_2627 | hypothetical protein | - |
NOQ94_RS13550 (2787026) | 2787026..2787934 | - | 909 | WP_077906523.1 | hypothetical protein | - |
NOQ94_RS13555 (2788207) | 2788207..2788538 | - | 332 | Protein_2629 | DUF1493 family protein | - |
NOQ94_RS13560 (2788624) | 2788624..2788743 | - | 120 | Protein_2630 | type II and III secretion system | - |
NOQ94_RS13565 (2788895) | 2788895..2789143 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NOQ94_RS13570 (2789133) | 2789133..2789417 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOQ94_RS13575 (2789588) | 2789588..2789977 | + | 390 | WP_000194089.1 | RidA family protein | - |
NOQ94_RS13580 (2790029) | 2790029..2791108 | - | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NOQ94_RS13585 (2791301) | 2791301..2791789 | - | 489 | WP_023223899.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NOQ94_RS13590 (2791834) | 2791834..2792697 | + | 864 | Protein_2636 | FAD-dependent monooxygenase | - |
NOQ94_RS13595 (2792681) | 2792681..2793247 | + | 567 | Protein_2637 | MFS transporter | - |
NOQ94_RS13600 (2793222) | 2793222..2794247 | + | 1026 | WP_000864928.1 | zinc-binding alcohol dehydrogenase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2781549..2792748 | 11199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T252423 WP_000221345.1 NZ_CP101647:2789133-2789417 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |