Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1394122..1394936 | Replicon | chromosome |
Accession | NZ_CP101647 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain KCID6 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3G3DUX8 |
Locus tag | NOQ94_RS06730 | Protein ID | WP_000971653.1 |
Coordinates | 1394122..1394649 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NOQ94_RS06735 | Protein ID | WP_000855694.1 |
Coordinates | 1394646..1394936 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ94_RS06700 (1390496) | 1390496..1390894 | + | 399 | Protein_1292 | cytoplasmic protein | - |
NOQ94_RS06705 (1391105) | 1391105..1391323 | + | 219 | Protein_1293 | hypothetical protein | - |
NOQ94_RS06710 (1391480) | 1391480..1392148 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NOQ94_RS06715 (1392175) | 1392175..1392669 | + | 495 | WP_000424946.1 | hypothetical protein | - |
NOQ94_RS06720 (1392841) | 1392841..1393497 | - | 657 | WP_023225036.1 | protein-serine/threonine phosphatase | - |
NOQ94_RS06725 (1393847) | 1393847..1394049 | + | 203 | Protein_1297 | IS5/IS1182 family transposase | - |
NOQ94_RS06730 (1394122) | 1394122..1394649 | - | 528 | WP_000971653.1 | GNAT family N-acetyltransferase | Toxin |
NOQ94_RS06735 (1394646) | 1394646..1394936 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NOQ94_RS06740 (1395207) | 1395207..1395407 | - | 201 | Protein_1300 | transposase | - |
NOQ94_RS06745 (1395648) | 1395648..1395974 | + | 327 | WP_000393295.1 | hypothetical protein | - |
NOQ94_RS06750 (1396247) | 1396247..1396595 | - | 349 | Protein_1302 | DUF1493 family protein | - |
NOQ94_RS06755 (1396580) | 1396580..1397029 | - | 450 | WP_023225038.1 | hypothetical protein | - |
NOQ94_RS06760 (1397461) | 1397461..1397904 | - | 444 | WP_023225039.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NOQ94_RS06765 (1398362) | 1398362..1399012 | + | 651 | WP_072203970.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invG / invE / invA / invB | 1392841..1404326 | 11485 | |
- | inside | IScluster/Tn | - | - | 1393873..1395407 | 1534 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19043.87 Da Isoelectric Point: 9.7032
>T252418 WP_000971653.1 NZ_CP101647:c1394649-1394122 [Salmonella enterica subsp. enterica serovar Kentucky]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT252418 WP_000855694.1 NZ_CP101647:c1394936-1394646 [Salmonella enterica subsp. enterica serovar Kentucky]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3DUX8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |