Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 691477..692268 | Replicon | chromosome |
Accession | NZ_CP101647 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain KCID6 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | C0Q119 |
Locus tag | NOQ94_RS03275 | Protein ID | WP_000369560.1 |
Coordinates | 691750..692268 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q57IR1 |
Locus tag | NOQ94_RS03270 | Protein ID | WP_001275017.1 |
Coordinates | 691477..691746 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOQ94_RS03250 (687058) | 687058..687726 | + | 669 | WP_000617729.1 | cell division ATP-binding protein FtsE | - |
NOQ94_RS03255 (687719) | 687719..688774 | + | 1056 | WP_001081707.1 | permease-like cell division protein FtsX | - |
NOQ94_RS03260 (689020) | 689020..689874 | + | 855 | WP_000159621.1 | RNA polymerase sigma factor RpoH | - |
NOQ94_RS03265 (690196) | 690196..691299 | + | 1104 | WP_001533929.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NOQ94_RS03270 (691477) | 691477..691746 | + | 270 | WP_001275017.1 | DUF1778 domain-containing protein | Antitoxin |
NOQ94_RS03275 (691750) | 691750..692268 | + | 519 | WP_000369560.1 | GNAT family N-acetyltransferase | Toxin |
NOQ94_RS03280 (692265) | 692265..692648 | - | 384 | WP_000778873.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NOQ94_RS03285 (693070) | 693070..694179 | + | 1110 | WP_023224165.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NOQ94_RS03290 (694239) | 694239..695165 | + | 927 | WP_000003005.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NOQ94_RS03295 (695162) | 695162..696439 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
NOQ94_RS03300 (696436) | 696436..697203 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19414.16 Da Isoelectric Point: 8.9619
>T252416 WP_000369560.1 NZ_CP101647:691750-692268 [Salmonella enterica subsp. enterica serovar Kentucky]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
Download Length: 519 bp
Antitoxin
Download Length: 90 a.a. Molecular weight: 10086.53 Da Isoelectric Point: 7.2056
>AT252416 WP_001275017.1 NZ_CP101647:691477-691746 [Salmonella enterica subsp. enterica serovar Kentucky]
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME
Download Length: 270 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5BA59 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I8URP5 |