Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2438532..2439097 | Replicon | chromosome |
Accession | NZ_CP101643 | ||
Organism | Lacticaseibacillus rhamnosus strain CLK 101 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | NOS86_RS11200 | Protein ID | WP_005692155.1 |
Coordinates | 2438532..2438879 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NOS86_RS11205 | Protein ID | WP_020752297.1 |
Coordinates | 2438879..2439097 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOS86_RS11180 (NOS86_11180) | 2434149..2435390 | - | 1242 | WP_005692160.1 | acyltransferase | - |
NOS86_RS11185 (NOS86_11185) | 2435387..2436088 | - | 702 | WP_064522467.1 | ATP-binding cassette domain-containing protein | - |
NOS86_RS11190 (NOS86_11190) | 2436081..2436899 | - | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
NOS86_RS11195 (NOS86_11195) | 2437140..2437808 | - | 669 | WP_005692157.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
NOS86_RS11200 (NOS86_11200) | 2438532..2438879 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NOS86_RS11205 (NOS86_11205) | 2438879..2439097 | - | 219 | WP_020752297.1 | hypothetical protein | Antitoxin |
NOS86_RS11210 (NOS86_11210) | 2439191..2441026 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein | - |
NOS86_RS11215 (NOS86_11215) | 2441013..2442803 | - | 1791 | WP_005692150.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T252410 WP_005692155.1 NZ_CP101643:c2438879-2438532 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|