Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1221843..1222760 | Replicon | chromosome |
Accession | NZ_CP101621 | ||
Organism | Bacillus velezensis strain 906 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | NN913_RS06435 | Protein ID | WP_003154806.1 |
Coordinates | 1222014..1222760 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | NN913_RS06430 | Protein ID | WP_255764242.1 |
Coordinates | 1221843..1222013 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NN913_RS06390 (NN913_06390) | 1217065..1218696 | + | 1632 | WP_255764241.1 | pyocin knob domain-containing protein | - |
NN913_RS06395 (NN913_06395) | 1218709..1219080 | + | 372 | WP_014304856.1 | XkdW family protein | - |
NN913_RS06400 (NN913_06400) | 1219086..1219283 | + | 198 | WP_003154819.1 | XkdX family protein | - |
NN913_RS06405 (NN913_06405) | 1219340..1220101 | + | 762 | WP_063174221.1 | hypothetical protein | - |
NN913_RS06410 (NN913_06410) | 1220153..1220416 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NN913_RS06415 (NN913_06415) | 1220430..1220693 | + | 264 | WP_003154813.1 | phage holin | - |
NN913_RS06420 (NN913_06420) | 1220707..1221585 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
NN913_RS06425 (NN913_06425) | 1221621..1221746 | - | 126 | WP_003154809.1 | hypothetical protein | - |
NN913_RS06430 (NN913_06430) | 1221843..1222013 | - | 171 | WP_255764242.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NN913_RS06435 (NN913_06435) | 1222014..1222760 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NN913_RS06440 (NN913_06440) | 1222865..1223863 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NN913_RS06445 (NN913_06445) | 1223876..1224493 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NN913_RS06450 (NN913_06450) | 1224779..1226095 | - | 1317 | WP_003154801.1 | amino acid permease | - |
NN913_RS06455 (NN913_06455) | 1226418..1227368 | + | 951 | WP_255764243.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1187241..1250316 | 63075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T252407 WP_003154806.1 NZ_CP101621:c1222760-1222014 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|