Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 478489..479126 | Replicon | chromosome |
Accession | NZ_CP101621 | ||
Organism | Bacillus velezensis strain 906 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NN913_RS02490 | Protein ID | WP_003156187.1 |
Coordinates | 478776..479126 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NN913_RS02485 | Protein ID | WP_003156188.1 |
Coordinates | 478489..478770 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NN913_RS02465 (NN913_02460) | 474854..475453 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NN913_RS02470 (NN913_02465) | 475546..475911 | + | 366 | WP_071392104.1 | holo-ACP synthase | - |
NN913_RS02475 (NN913_02470) | 476076..477083 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
NN913_RS02480 (NN913_02475) | 477200..478369 | + | 1170 | WP_003156189.1 | alanine racemase | - |
NN913_RS02485 (NN913_02480) | 478489..478770 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NN913_RS02490 (NN913_02485) | 478776..479126 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NN913_RS02495 (NN913_02490) | 479244..480065 | + | 822 | WP_014304404.1 | STAS domain-containing protein | - |
NN913_RS02500 (NN913_02495) | 480070..480435 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NN913_RS02505 (NN913_02500) | 480438..480839 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NN913_RS02510 (NN913_02505) | 480851..481858 | + | 1008 | WP_255764145.1 | PP2C family protein-serine/threonine phosphatase | - |
NN913_RS02515 (NN913_02510) | 481922..482251 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NN913_RS02520 (NN913_02515) | 482248..482730 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
NN913_RS02525 (NN913_02520) | 482696..483484 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NN913_RS02530 (NN913_02525) | 483484..484086 | + | 603 | WP_255764146.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T252406 WP_003156187.1 NZ_CP101621:478776-479126 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|