Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 27386..27911 | Replicon | plasmid pDC71-3 |
Accession | NZ_CP101618 | ||
Organism | Escherichia coli strain DC71 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NOF56_RS24040 | Protein ID | WP_001159868.1 |
Coordinates | 27606..27911 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A223LLB0 |
Locus tag | NOF56_RS24035 | Protein ID | WP_023909027.1 |
Coordinates | 27386..27604 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOF56_RS24020 (25121) | 25121..26254 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
NOF56_RS24025 (26274) | 26274..26558 | + | 285 | WP_000642771.1 | hypothetical protein | - |
NOF56_RS24030 (26555) | 26555..26752 | - | 198 | WP_000215657.1 | hypothetical protein | - |
NOF56_RS24035 (27386) | 27386..27604 | + | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NOF56_RS24040 (27606) | 27606..27911 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NOF56_RS24045 (27912) | 27912..28718 | + | 807 | WP_000016982.1 | site-specific integrase | - |
NOF56_RS24050 (29492) | 29492..30247 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NOF56_RS24055 (30835) | 30835..32001 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / aadA5 / sul1 / tet(B) | - | 1..72929 | 72929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T252401 WP_001159868.1 NZ_CP101618:27606-27911 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|