Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 20789..21432 | Replicon | plasmid pDC71-3 |
Accession | NZ_CP101618 | ||
Organism | Escherichia coli strain DC71 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | NOF56_RS24005 | Protein ID | WP_001044768.1 |
Coordinates | 20789..21205 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | NOF56_RS24010 | Protein ID | WP_001261287.1 |
Coordinates | 21202..21432 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOF56_RS23990 (16093) | 16093..16986 | - | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
NOF56_RS23995 (17029) | 17029..18024 | - | 996 | WP_000246636.1 | hypothetical protein | - |
NOF56_RS24000 (18489) | 18489..20627 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
NOF56_RS24005 (20789) | 20789..21205 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NOF56_RS24010 (21202) | 21202..21432 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NOF56_RS24015 (21739) | 21739..24858 | + | 3120 | WP_023909028.1 | hypothetical protein | - |
NOF56_RS24020 (25121) | 25121..26254 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / aadA5 / sul1 / tet(B) | - | 1..72929 | 72929 | |
- | flank | IS/Tn | - | - | 15453..15956 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T252400 WP_001044768.1 NZ_CP101618:c21205-20789 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |