Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 23847..24448 Replicon plasmid pDC71-1
Accession NZ_CP101616
Organism Escherichia coli strain DC71

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag NOF56_RS23025 Protein ID WP_001216045.1
Coordinates 23847..24227 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NOF56_RS23030 Protein ID WP_001190712.1
Coordinates 24227..24448 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOF56_RS23000 (NOF56_22995) 19288..20730 - 1443 WP_223656860.1 terminase -
NOF56_RS23005 (NOF56_23000) 20772..21965 - 1194 WP_072665124.1 terminase -
NOF56_RS23010 (NOF56_23005) 22051..22503 - 453 WP_001326849.1 late promoter-activating protein -
NOF56_RS23015 (NOF56_23010) 22592..23635 - 1044 WP_255862063.1 DUF968 domain-containing protein -
NOF56_RS23020 (NOF56_23015) 23663..23842 - 180 WP_000113018.1 hypothetical protein -
NOF56_RS23025 (NOF56_23020) 23847..24227 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NOF56_RS23030 (NOF56_23025) 24227..24448 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NOF56_RS23035 (NOF56_23030) 24521..24910 - 390 WP_000506726.1 S24 family peptidase -
NOF56_RS23040 (NOF56_23035) 25034..25285 - 252 WP_032153798.1 DNA polymerase III subunit theta -
NOF56_RS23045 (NOF56_23040) 25600..26373 - 774 WP_223677252.1 hypothetical protein -
NOF56_RS23050 (NOF56_23045) 26355..26729 - 375 WP_032353387.1 hypothetical protein -
NOF56_RS23055 (NOF56_23050) 26736..27029 - 294 WP_000269001.1 hypothetical protein -
NOF56_RS23060 (NOF56_23055) 27208..27441 - 234 WP_000517421.1 hypothetical protein -
NOF56_RS23065 (NOF56_23060) 27524..28210 - 687 WP_234287463.1 DUF550 domain-containing protein -
NOF56_RS23070 (NOF56_23065) 28184..28309 - 126 Protein_30 DUF550 domain-containing protein -
NOF56_RS23075 (NOF56_23070) 28306..28515 - 210 WP_153061224.1 hypothetical protein -
NOF56_RS23080 (NOF56_23075) 28517..28912 - 396 WP_241408132.1 hypothetical protein -
NOF56_RS23085 (NOF56_23080) 29246..29424 - 179 Protein_33 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..92506 92506


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T252398 WP_001216045.1 NZ_CP101616:c24227-23847 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT252398 WP_001190712.1 NZ_CP101616:c24448-24227 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References