Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3515219..3515837 | Replicon | chromosome |
Accession | NZ_CP101615 | ||
Organism | Escherichia coli strain DC71 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NOF56_RS16995 | Protein ID | WP_001291435.1 |
Coordinates | 3515619..3515837 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NOF56_RS16990 | Protein ID | WP_000344800.1 |
Coordinates | 3515219..3515593 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOF56_RS16980 (3510308) | 3510308..3511501 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NOF56_RS16985 (3511524) | 3511524..3514673 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NOF56_RS16990 (3515219) | 3515219..3515593 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NOF56_RS16995 (3515619) | 3515619..3515837 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NOF56_RS17000 (3516009) | 3516009..3516560 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
NOF56_RS17005 (3516676) | 3516676..3517146 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NOF56_RS17010 (3517310) | 3517310..3518860 | + | 1551 | WP_001372022.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NOF56_RS17015 (3518902) | 3518902..3519255 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NOF56_RS17025 (3519634) | 3519634..3519945 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NOF56_RS17030 (3519976) | 3519976..3520548 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252396 WP_001291435.1 NZ_CP101615:3515619-3515837 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT252396 WP_000344800.1 NZ_CP101615:3515219-3515593 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |