Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2810396..2811240 Replicon chromosome
Accession NZ_CP101615
Organism Escherichia coli strain DC71

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag NOF56_RS13630 Protein ID WP_000854686.1
Coordinates 2810396..2810779 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag NOF56_RS13635 Protein ID WP_001285602.1
Coordinates 2810860..2811240 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOF56_RS13590 (2805399) 2805399..2805890 - 492 WP_001297187.1 DUF1097 domain-containing protein -
NOF56_RS13595 (2805992) 2805992..2806546 - 555 WP_001001902.1 molecular chaperone YcdY -
NOF56_RS13600 (2806570) 2806570..2807307 - 738 WP_000283664.1 zinc-binding phosphatase -
NOF56_RS13605 (2807362) 2807362..2808300 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
NOF56_RS13615 (2808771) 2808771..2809612 - 842 Protein_2667 DUF4942 domain-containing protein -
NOF56_RS13620 (2809697) 2809697..2809894 - 198 WP_000839253.1 DUF957 domain-containing protein -
NOF56_RS13625 (2809911) 2809911..2810399 - 489 WP_032180032.1 DUF5983 family protein -
NOF56_RS13630 (2810396) 2810396..2810779 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
NOF56_RS13635 (2810860) 2810860..2811240 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NOF56_RS13640 (2811251) 2811251..2811934 - 684 WP_000086768.1 hypothetical protein -
NOF56_RS13645 (2811953) 2811953..2812174 - 222 WP_000692298.1 DUF987 domain-containing protein -
NOF56_RS13650 (2812237) 2812237..2812713 - 477 WP_001186726.1 RadC family protein -
NOF56_RS13655 (2812729) 2812729..2813214 - 486 WP_000214307.1 antirestriction protein -
NOF56_RS13660 (2813306) 2813306..2814127 - 822 WP_001761104.1 DUF932 domain-containing protein -
NOF56_RS13665 (2814228) 2814228..2814436 - 209 Protein_2677 DUF905 domain-containing protein -
NOF56_RS13670 (2814537) 2814537..2814992 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T252394 WP_000854686.1 NZ_CP101615:c2810779-2810396 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT252394 WP_001285602.1 NZ_CP101615:c2811240-2810860 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References