Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1345591..1346216 | Replicon | chromosome |
| Accession | NZ_CP101615 | ||
| Organism | Escherichia coli strain DC71 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NOF56_RS06540 | Protein ID | WP_000911330.1 |
| Coordinates | 1345818..1346216 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NOF56_RS06535 | Protein ID | WP_000450524.1 |
| Coordinates | 1345591..1345818 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOF56_RS06510 (1341394) | 1341394..1341864 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NOF56_RS06515 (1341864) | 1341864..1342436 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NOF56_RS06520 (1342582) | 1342582..1343460 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NOF56_RS06525 (1343477) | 1343477..1344511 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NOF56_RS06530 (1344724) | 1344724..1345437 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NOF56_RS06535 (1345591) | 1345591..1345818 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NOF56_RS06540 (1345818) | 1345818..1346216 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NOF56_RS06545 (1346363) | 1346363..1347226 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| NOF56_RS06550 (1347241) | 1347241..1349256 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NOF56_RS06555 (1349330) | 1349330..1349671 | + | 342 | Protein_1280 | esterase | - |
| NOF56_RS06560 (1349753) | 1349753..1350497 | - | 745 | Protein_1281 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T252387 WP_000911330.1 NZ_CP101615:1345818-1346216 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|