Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1046214..1046797 | Replicon | chromosome |
Accession | NZ_CP101615 | ||
Organism | Escherichia coli strain DC71 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NOF56_RS05090 | Protein ID | WP_000254738.1 |
Coordinates | 1046462..1046797 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NOF56_RS05085 | Protein ID | WP_000581937.1 |
Coordinates | 1046214..1046462 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOF56_RS05075 (1042553) | 1042553..1043854 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NOF56_RS05080 (1043902) | 1043902..1046136 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NOF56_RS05085 (1046214) | 1046214..1046462 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NOF56_RS05090 (1046462) | 1046462..1046797 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NOF56_RS05095 (1046868) | 1046868..1047659 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NOF56_RS05100 (1047887) | 1047887..1049524 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NOF56_RS05105 (1049612) | 1049612..1050910 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T252385 WP_000254738.1 NZ_CP101615:1046462-1046797 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|