Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 903555..904209 | Replicon | chromosome |
Accession | NZ_CP101615 | ||
Organism | Escherichia coli strain DC71 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NOF56_RS04435 | Protein ID | WP_000244777.1 |
Coordinates | 903802..904209 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NOF56_RS04430 | Protein ID | WP_000354046.1 |
Coordinates | 903555..903821 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOF56_RS04405 (898843) | 898843..899586 | + | 744 | Protein_864 | SDR family oxidoreductase | - |
NOF56_RS04410 (899643) | 899643..901076 | - | 1434 | WP_138412971.1 | 6-phospho-beta-glucosidase BglA | - |
NOF56_RS04415 (901121) | 901121..901432 | + | 312 | WP_001679467.1 | N(4)-acetylcytidine aminohydrolase | - |
NOF56_RS04420 (901596) | 901596..902255 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NOF56_RS04425 (902332) | 902332..903312 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NOF56_RS04430 (903555) | 903555..903821 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NOF56_RS04435 (903802) | 903802..904209 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
NOF56_RS04440 (904249) | 904249..904770 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NOF56_RS04445 (904882) | 904882..905778 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NOF56_RS04450 (905803) | 905803..906513 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NOF56_RS04455 (906519) | 906519..908252 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T252384 WP_000244777.1 NZ_CP101615:903802-904209 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |