Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49342..50143 | Replicon | chromosome |
| Accession | NZ_CP101615 | ||
| Organism | Escherichia coli strain DC71 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0E0XS49 |
| Locus tag | NOF56_RS00255 | Protein ID | WP_001094437.1 |
| Coordinates | 49342..49719 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0E0XTQ1 |
| Locus tag | NOF56_RS00260 | Protein ID | WP_001390338.1 |
| Coordinates | 49766..50143 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOF56_RS00225 (44699) | 44699..45622 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| NOF56_RS00230 (45733) | 45733..46917 | - | 1185 | WP_001172877.1 | sugar efflux transporter | - |
| NOF56_RS00235 (47347) | 47347..47475 | - | 129 | Protein_46 | virulence RhuM family protein | - |
| NOF56_RS00240 (47710) | 47710..48555 | - | 846 | WP_001274561.1 | DUF4942 domain-containing protein | - |
| NOF56_RS00245 (48640) | 48640..48837 | - | 198 | WP_000772032.1 | DUF957 domain-containing protein | - |
| NOF56_RS00250 (48857) | 48857..49345 | - | 489 | WP_000761716.1 | DUF5983 family protein | - |
| NOF56_RS00255 (49342) | 49342..49719 | - | 378 | WP_001094437.1 | TA system toxin CbtA family protein | Toxin |
| NOF56_RS00260 (49766) | 49766..50143 | - | 378 | WP_001390338.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NOF56_RS00265 (50306) | 50306..50527 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NOF56_RS00270 (50590) | 50590..51066 | - | 477 | WP_001186747.1 | RadC family protein | - |
| NOF56_RS00275 (51082) | 51082..51252 | - | 171 | Protein_54 | antirestriction protein | - |
| NOF56_RS00280 (51254) | 51254..52018 | - | 765 | Protein_55 | autotransporter adhesin family protein | - |
| NOF56_RS00285 (52390) | 52390..53154 | - | 765 | WP_162869019.1 | GTPase family protein | - |
| NOF56_RS00290 (53544) | 53544..53755 | + | 212 | Protein_57 | hemolysin expression modulator Hha | - |
| NOF56_RS00295 (54098) | 54098..54295 | - | 198 | WP_001545803.1 | hypothetical protein | - |
| NOF56_RS00300 (54499) | 54499..55068 | + | 570 | WP_000148641.1 | inovirus Gp2 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.90 Da Isoelectric Point: 7.3223
>T252379 WP_001094437.1 NZ_CP101615:c49719-49342 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13745.44 Da Isoelectric Point: 5.0463
>AT252379 WP_001390338.1 NZ_CP101615:c50143-49766 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XS49 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTQ1 |