Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3586897..3587525 Replicon chromosome
Accession NZ_CP101613
Organism Erwinia persicina strain SR15

Toxin (Protein)


Gene name Hha Uniprot ID D2T444
Locus tag NOG67_RS16770 Protein ID WP_004156337.1
Coordinates 3587307..3587525 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A3S7S5Y4
Locus tag NOG67_RS16765 Protein ID WP_062744996.1
Coordinates 3586897..3587277 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOG67_RS16735 (NOG67_16705) 3582077..3582220 + 144 WP_062745007.1 type B 50S ribosomal protein L36 -
NOG67_RS16740 (NOG67_16710) 3582481..3583512 + 1032 WP_062745004.1 hypothetical protein -
NOG67_RS16745 (NOG67_16715) 3583553..3584431 - 879 WP_255851039.1 metal ABC transporter substrate-binding protein -
NOG67_RS16750 (NOG67_16720) 3584428..3585297 - 870 WP_062745000.1 metal ABC transporter permease -
NOG67_RS16755 (NOG67_16725) 3585294..3585983 - 690 WP_118665845.1 ATP-binding cassette domain-containing protein -
NOG67_RS16760 (NOG67_16730) 3586396..3586749 + 354 WP_161975948.1 hypothetical protein -
NOG67_RS16765 (NOG67_16735) 3586897..3587277 + 381 WP_062744996.1 Hha toxicity modulator TomB Antitoxin
NOG67_RS16770 (NOG67_16740) 3587307..3587525 + 219 WP_004156337.1 HHA domain-containing protein Toxin
NOG67_RS16780 (NOG67_16750) 3587817..3588131 + 315 WP_062744994.1 MGMT family protein -
NOG67_RS16785 (NOG67_16755) 3588160..3588717 - 558 WP_062744992.1 YbaY family lipoprotein -
NOG67_RS16790 (NOG67_16760) 3588945..3589805 + 861 WP_062744990.1 acyl-CoA thioesterase II -
NOG67_RS16795 (NOG67_16765) 3589887..3591188 - 1302 WP_118664527.1 ammonium transporter AmtB -
NOG67_RS16800 (NOG67_16770) 3591208..3591546 - 339 WP_007886947.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8627.06 Da        Isoelectric Point: 8.9007

>T252378 WP_004156337.1 NZ_CP101613:3587307-3587525 [Erwinia persicina]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 14645.29 Da        Isoelectric Point: 4.5911

>AT252378 WP_062744996.1 NZ_CP101613:3586897-3587277 [Erwinia persicina]
MDEYSPRRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSVANLQLNDLIEHIAAFTMNYKIKHIEDVDLISQVDEYL
DDTFTLFSNYGINVQDLQRWQKCAKRLFNIFAEECSTARTQASHSF

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A831EPQ0

Antitoxin

Source ID Structure
AlphaFold DB A0A3S7S5Y4

References