Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3586897..3587525 | Replicon | chromosome |
| Accession | NZ_CP101613 | ||
| Organism | Erwinia persicina strain SR15 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D2T444 |
| Locus tag | NOG67_RS16770 | Protein ID | WP_004156337.1 |
| Coordinates | 3587307..3587525 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A3S7S5Y4 |
| Locus tag | NOG67_RS16765 | Protein ID | WP_062744996.1 |
| Coordinates | 3586897..3587277 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOG67_RS16735 (NOG67_16705) | 3582077..3582220 | + | 144 | WP_062745007.1 | type B 50S ribosomal protein L36 | - |
| NOG67_RS16740 (NOG67_16710) | 3582481..3583512 | + | 1032 | WP_062745004.1 | hypothetical protein | - |
| NOG67_RS16745 (NOG67_16715) | 3583553..3584431 | - | 879 | WP_255851039.1 | metal ABC transporter substrate-binding protein | - |
| NOG67_RS16750 (NOG67_16720) | 3584428..3585297 | - | 870 | WP_062745000.1 | metal ABC transporter permease | - |
| NOG67_RS16755 (NOG67_16725) | 3585294..3585983 | - | 690 | WP_118665845.1 | ATP-binding cassette domain-containing protein | - |
| NOG67_RS16760 (NOG67_16730) | 3586396..3586749 | + | 354 | WP_161975948.1 | hypothetical protein | - |
| NOG67_RS16765 (NOG67_16735) | 3586897..3587277 | + | 381 | WP_062744996.1 | Hha toxicity modulator TomB | Antitoxin |
| NOG67_RS16770 (NOG67_16740) | 3587307..3587525 | + | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
| NOG67_RS16780 (NOG67_16750) | 3587817..3588131 | + | 315 | WP_062744994.1 | MGMT family protein | - |
| NOG67_RS16785 (NOG67_16755) | 3588160..3588717 | - | 558 | WP_062744992.1 | YbaY family lipoprotein | - |
| NOG67_RS16790 (NOG67_16760) | 3588945..3589805 | + | 861 | WP_062744990.1 | acyl-CoA thioesterase II | - |
| NOG67_RS16795 (NOG67_16765) | 3589887..3591188 | - | 1302 | WP_118664527.1 | ammonium transporter AmtB | - |
| NOG67_RS16800 (NOG67_16770) | 3591208..3591546 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T252378 WP_004156337.1 NZ_CP101613:3587307-3587525 [Erwinia persicina]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14645.29 Da Isoelectric Point: 4.5911
>AT252378 WP_062744996.1 NZ_CP101613:3586897-3587277 [Erwinia persicina]
MDEYSPRRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSVANLQLNDLIEHIAAFTMNYKIKHIEDVDLISQVDEYL
DDTFTLFSNYGINVQDLQRWQKCAKRLFNIFAEECSTARTQASHSF
MDEYSPRRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSVANLQLNDLIEHIAAFTMNYKIKHIEDVDLISQVDEYL
DDTFTLFSNYGINVQDLQRWQKCAKRLFNIFAEECSTARTQASHSF
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A831EPQ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S7S5Y4 |