Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 873993..874653 | Replicon | chromosome |
Accession | NZ_CP101613 | ||
Organism | Erwinia persicina strain SR15 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NOG67_RS04015 | Protein ID | WP_255851444.1 |
Coordinates | 874240..874653 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A354DN60 |
Locus tag | NOG67_RS04010 | Protein ID | WP_062744288.1 |
Coordinates | 873993..874259 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOG67_RS03990 (NOG67_03980) | 870445..871188 | + | 744 | WP_118663257.1 | SDR family oxidoreductase | - |
NOG67_RS03995 (NOG67_03985) | 871293..871901 | - | 609 | WP_062744290.1 | HD domain-containing protein | - |
NOG67_RS04000 (NOG67_03990) | 872111..872764 | + | 654 | WP_062744348.1 | hemolysin III family protein | - |
NOG67_RS04005 (NOG67_03995) | 872780..873766 | - | 987 | WP_255851443.1 | tRNA-modifying protein YgfZ | - |
NOG67_RS04010 (NOG67_04000) | 873993..874259 | + | 267 | WP_062744288.1 | FAD assembly factor SdhE | Antitoxin |
NOG67_RS04015 (NOG67_04005) | 874240..874653 | + | 414 | WP_255851444.1 | protein YgfX | Toxin |
NOG67_RS04020 (NOG67_04010) | 874646..875341 | + | 696 | WP_062744286.1 | two-component system response regulator CreB | - |
NOG67_RS04025 (NOG67_04015) | 875341..876765 | + | 1425 | WP_255851445.1 | two-component system sensor histidine kinase CreC | - |
NOG67_RS04030 (NOG67_04020) | 876848..878209 | + | 1362 | WP_137269030.1 | cell envelope integrity protein CreD | - |
NOG67_RS04035 (NOG67_04025) | 878307..878825 | - | 519 | WP_255851446.1 | flavodoxin FldB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16136.90 Da Isoelectric Point: 11.8432
>T252377 WP_255851444.1 NZ_CP101613:874240-874653 [Erwinia persicina]
VVRCHCNLRLSRHAQSSSLLLHGGVMLLLLLAPWPPEASLVKVALLLLTGGECLRSCRRTRRWQGLFVLLSGRRVQWHQA
QWQMVSPPWMTRHAVRLSLRDNQGRHERLWLFADGMDNSEWRLLRQQLLSKKEWRDE
VVRCHCNLRLSRHAQSSSLLLHGGVMLLLLLAPWPPEASLVKVALLLLTGGECLRSCRRTRRWQGLFVLLSGRRVQWHQA
QWQMVSPPWMTRHAVRLSLRDNQGRHERLWLFADGMDNSEWRLLRQQLLSKKEWRDE
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|