Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2280525..2281447 | Replicon | chromosome |
Accession | NZ_CP101610 | ||
Organism | Bacillus siamensis strain WYJ-E14 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A120KSF0 |
Locus tag | NNG64_RS10915 | Protein ID | WP_060962999.1 |
Coordinates | 2280525..2281277 (+) | Length | 251 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NNG64_RS10920 | Protein ID | WP_003154807.1 |
Coordinates | 2281277..2281447 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNG64_RS10895 (2275915) | 2275915..2276865 | - | 951 | WP_060962997.1 | ring-cleaving dioxygenase | - |
NNG64_RS10900 (2277188) | 2277188..2278504 | + | 1317 | WP_060962998.1 | amino acid permease | - |
NNG64_RS10905 (2278789) | 2278789..2279406 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
NNG64_RS10910 (2279419) | 2279419..2280417 | + | 999 | WP_044802872.1 | inorganic phosphate transporter | - |
NNG64_RS10915 (2280525) | 2280525..2281277 | + | 753 | WP_060962999.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NNG64_RS10920 (2281277) | 2281277..2281447 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NNG64_RS10925 (2281544) | 2281544..2281669 | + | 126 | WP_141228459.1 | hypothetical protein | - |
NNG64_RS10930 (2281706) | 2281706..2282584 | - | 879 | WP_060963000.1 | N-acetylmuramoyl-L-alanine amidase | - |
NNG64_RS10935 (2282598) | 2282598..2282861 | - | 264 | WP_016936430.1 | phage holin | - |
NNG64_RS10940 (2282875) | 2282875..2283138 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NNG64_RS10945 (2283190) | 2283190..2283990 | - | 801 | WP_060965050.1 | hypothetical protein | - |
NNG64_RS10950 (2284042) | 2284042..2284206 | - | 165 | WP_060963001.1 | XkdX family protein | - |
NNG64_RS10955 (2284206) | 2284206..2284538 | - | 333 | WP_060963002.1 | XkdW family protein | - |
NNG64_RS10960 (2284559) | 2284559..2286292 | - | 1734 | WP_060963003.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 251 a.a. Molecular weight: 29357.82 Da Isoelectric Point: 4.5756
>T252375 WP_060962999.1 NZ_CP101610:2280525-2281277 [Bacillus siamensis]
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFSAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSETLLTEFDYLLFTSLTSIYDLML
PIEEEEEGDG
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFSAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSETLLTEFDYLLFTSLTSIYDLML
PIEEEEEGDG
Download Length: 753 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A120KSF0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |