Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 477083..477720 | Replicon | chromosome |
Accession | NZ_CP101610 | ||
Organism | Bacillus siamensis strain WYJ-E14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NNG64_RS02440 | Protein ID | WP_003156187.1 |
Coordinates | 477370..477720 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NNG64_RS02435 | Protein ID | WP_003156188.1 |
Coordinates | 477083..477364 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNG64_RS02415 (473449) | 473449..474048 | - | 600 | WP_016937174.1 | rhomboid family intramembrane serine protease | - |
NNG64_RS02420 (474141) | 474141..474506 | + | 366 | WP_060963545.1 | holo-ACP synthase | - |
NNG64_RS02425 (474671) | 474671..475678 | + | 1008 | WP_016937172.1 | outer membrane lipoprotein carrier protein LolA | - |
NNG64_RS02430 (475794) | 475794..476963 | + | 1170 | WP_016937171.1 | alanine racemase | - |
NNG64_RS02435 (477083) | 477083..477364 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NNG64_RS02440 (477370) | 477370..477720 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NNG64_RS02445 (477841) | 477841..478662 | + | 822 | WP_060963544.1 | STAS domain-containing protein | - |
NNG64_RS02450 (478667) | 478667..479032 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NNG64_RS02455 (479035) | 479035..479436 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NNG64_RS02460 (479448) | 479448..480455 | + | 1008 | WP_016937170.1 | PP2C family protein-serine/threonine phosphatase | - |
NNG64_RS02465 (480519) | 480519..480848 | + | 330 | WP_016937169.1 | anti-sigma factor antagonist | - |
NNG64_RS02470 (480845) | 480845..481327 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
NNG64_RS02475 (481293) | 481293..482081 | + | 789 | WP_060963543.1 | RNA polymerase sigma factor SigB | - |
NNG64_RS02480 (482081) | 482081..482683 | + | 603 | WP_060963542.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T252374 WP_003156187.1 NZ_CP101610:477370-477720 [Bacillus siamensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|