Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 547697..548333 | Replicon | chromosome |
| Accession | NZ_CP101609 | ||
| Organism | Bacillus altitudinis strain 47 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K2MHT4 |
| Locus tag | NMH04_RS02620 | Protein ID | WP_003214169.1 |
| Coordinates | 547983..548333 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A267X601 |
| Locus tag | NMH04_RS02615 | Protein ID | WP_012008995.1 |
| Coordinates | 547697..547978 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMH04_RS02595 (NMH04_02590) | 543851..544456 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
| NMH04_RS02600 (NMH04_02595) | 544551..544916 | + | 366 | WP_255816870.1 | holo-ACP synthase | - |
| NMH04_RS02605 (NMH04_02600) | 545077..546093 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
| NMH04_RS02610 (NMH04_02605) | 546222..547403 | + | 1182 | WP_255816871.1 | alanine racemase | - |
| NMH04_RS02615 (NMH04_02610) | 547697..547978 | + | 282 | WP_012008995.1 | hypothetical protein | Antitoxin |
| NMH04_RS02620 (NMH04_02615) | 547983..548333 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NMH04_RS02625 (NMH04_02620) | 548448..549278 | + | 831 | WP_024719204.1 | RsbT co-antagonist protein RsbRA | - |
| NMH04_RS02630 (NMH04_02625) | 549283..549651 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| NMH04_RS02635 (NMH04_02630) | 549654..550055 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
| NMH04_RS02640 (NMH04_02635) | 550066..551073 | + | 1008 | WP_061418047.1 | PP2C family protein-serine/threonine phosphatase | - |
| NMH04_RS02645 (NMH04_02640) | 551133..551462 | + | 330 | WP_113767289.1 | anti-sigma factor antagonist | - |
| NMH04_RS02650 (NMH04_02645) | 551459..551947 | + | 489 | WP_007496471.1 | anti-sigma B factor RsbW | - |
| NMH04_RS02655 (NMH04_02650) | 551913..552701 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
| NMH04_RS02660 (NMH04_02655) | 552701..553300 | + | 600 | WP_024719202.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T252373 WP_003214169.1 NZ_CP101609:547983-548333 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K2MHT4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A267X601 |