Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 14491..15134 | Replicon | plasmid pA84-2 |
| Accession | NZ_CP101597 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NNQ27_RS22640 | Protein ID | WP_275886476.1 |
| Coordinates | 14718..15134 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NNQ27_RS22635 | Protein ID | WP_275886475.1 |
| Coordinates | 14491..14721 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS22610 (NNQ27_22610) | 9932..10891 | - | 960 | WP_275886471.1 | cupin domain-containing protein | - |
| NNQ27_RS22615 (NNQ27_22615) | 10891..12087 | - | 1197 | WP_275886472.1 | MFS transporter | - |
| NNQ27_RS22620 (NNQ27_22620) | 12089..12790 | - | 702 | WP_275886473.1 | class I SAM-dependent methyltransferase | - |
| NNQ27_RS22625 (NNQ27_22625) | 12793..13059 | - | 267 | WP_076738041.1 | PqqD family protein | - |
| NNQ27_RS22630 (NNQ27_22630) | 13421..13906 | + | 486 | WP_275886474.1 | GNAT family N-acetyltransferase | - |
| NNQ27_RS22635 (NNQ27_22635) | 14491..14721 | + | 231 | WP_275886475.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NNQ27_RS22640 (NNQ27_22640) | 14718..15134 | + | 417 | WP_275886476.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NNQ27_RS22645 (NNQ27_22645) | 15176..16054 | - | 879 | WP_275886477.1 | restriction endonuclease | - |
| NNQ27_RS22650 (NNQ27_22650) | 16559..17725 | + | 1167 | WP_275886478.1 | hypothetical protein | - |
| NNQ27_RS22655 (NNQ27_22655) | 18256..19188 | - | 933 | WP_275886479.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..38910 | 38910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15103.54 Da Isoelectric Point: 6.7053
>T252371 WP_275886476.1 NZ_CP101597:14718-15134 [Cronobacter dublinensis]
VNTTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGLKASLRHVQLVEEFCARLDAVLPWDRA
AVDATTEIKVALRLAGTPIGANDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
VNTTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGLKASLRHVQLVEEFCARLDAVLPWDRA
AVDATTEIKVALRLAGTPIGANDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|