Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4283462..4284011 | Replicon | chromosome |
| Accession | NZ_CP101595 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | NNQ27_RS20675 | Protein ID | WP_105650996.1 |
| Coordinates | 4283462..4283770 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | NNQ27_RS20680 | Protein ID | WP_199782776.1 |
| Coordinates | 4283772..4284011 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS20655 (NNQ27_20655) | 4278700..4279458 | - | 759 | WP_275885317.1 | SDR family oxidoreductase | - |
| NNQ27_RS20660 (NNQ27_20660) | 4279577..4280476 | + | 900 | WP_275885318.1 | LysR family transcriptional regulator | - |
| NNQ27_RS20665 (NNQ27_20665) | 4280529..4281563 | + | 1035 | WP_038874348.1 | inner membrane protein YhjD | - |
| NNQ27_RS20670 (NNQ27_20670) | 4281838..4283166 | + | 1329 | WP_275885319.1 | MFS transporter | - |
| NNQ27_RS20675 (NNQ27_20675) | 4283462..4283770 | - | 309 | WP_105650996.1 | CcdB family protein | Toxin |
| NNQ27_RS20680 (NNQ27_20680) | 4283772..4284011 | - | 240 | WP_199782776.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NNQ27_RS20685 (NNQ27_20685) | 4284129..4286186 | - | 2058 | WP_275885320.1 | AsmA family protein | - |
| NNQ27_RS20690 (NNQ27_20690) | 4286251..4287024 | - | 774 | WP_007753642.1 | cyclic-guanylate-specific phosphodiesterase | - |
| NNQ27_RS20695 (NNQ27_20695) | 4287257..4288189 | + | 933 | WP_275885321.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11716.61 Da Isoelectric Point: 6.2118
>T252369 WP_105650996.1 NZ_CP101595:c4283770-4283462 [Cronobacter dublinensis]
MQYQIYRNTSTNKKYPYLIDVQSDLIDVLTTRVVIPLVPRFMAQKPLPERMCPVVEVDGDEYIVMTHEMASVGKSVLGEH
AASALPWRQHIKNAIDFMFDGF
MQYQIYRNTSTNKKYPYLIDVQSDLIDVLTTRVVIPLVPRFMAQKPLPERMCPVVEVDGDEYIVMTHEMASVGKSVLGEH
AASALPWRQHIKNAIDFMFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|