Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3639874..3640534 | Replicon | chromosome |
| Accession | NZ_CP101595 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NNQ27_RS17540 | Protein ID | WP_275885082.1 |
| Coordinates | 3639874..3640287 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | K8AL19 |
| Locus tag | NNQ27_RS17545 | Protein ID | WP_007718966.1 |
| Coordinates | 3640268..3640534 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS17520 (NNQ27_17520) | 3635860..3637593 | - | 1734 | WP_105633468.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NNQ27_RS17525 (NNQ27_17525) | 3637597..3638316 | - | 720 | WP_105647597.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NNQ27_RS17530 (NNQ27_17530) | 3638339..3639235 | - | 897 | WP_275885081.1 | site-specific tyrosine recombinase XerD | - |
| NNQ27_RS17535 (NNQ27_17535) | 3639337..3639858 | + | 522 | WP_007718971.1 | flavodoxin FldB | - |
| NNQ27_RS17540 (NNQ27_17540) | 3639874..3640287 | - | 414 | WP_275885082.1 | protein YgfX | Toxin |
| NNQ27_RS17545 (NNQ27_17545) | 3640268..3640534 | - | 267 | WP_007718966.1 | FAD assembly factor SdhE | Antitoxin |
| NNQ27_RS17550 (NNQ27_17550) | 3640812..3641801 | + | 990 | WP_275885083.1 | tRNA-modifying protein YgfZ | - |
| NNQ27_RS17555 (NNQ27_17555) | 3641929..3642582 | - | 654 | WP_275885084.1 | hemolysin III family protein | - |
| NNQ27_RS17560 (NNQ27_17560) | 3642747..3643061 | - | 315 | WP_161573301.1 | N(4)-acetylcytidine aminohydrolase | - |
| NNQ27_RS17565 (NNQ27_17565) | 3643239..3643967 | + | 729 | WP_275886327.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16375.39 Da Isoelectric Point: 11.4887
>T252367 WP_275885082.1 NZ_CP101595:c3640287-3639874 [Cronobacter dublinensis]
VVLWHSDLRVSWRSQWVSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFHGEVSLTADYQLRWQGV
DWEICATPWMLRSGMMLRLRHPKTTRSHHVWLASDSMMAKEWRDLRRLLLQQPVRDR
VVLWHSDLRVSWRSQWVSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFHGEVSLTADYQLRWQGV
DWEICATPWMLRSGMMLRLRHPKTTRSHHVWLASDSMMAKEWRDLRRLLLQQPVRDR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|