Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2836784..2837374 | Replicon | chromosome |
| Accession | NZ_CP101595 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NNQ27_RS13750 | Protein ID | WP_105635764.1 |
| Coordinates | 2836784..2837116 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NNQ27_RS13755 | Protein ID | WP_275884813.1 |
| Coordinates | 2837117..2837374 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS13720 (NNQ27_13730) | 2831879..2832784 | + | 906 | WP_038870960.1 | LysR family transcriptional regulator | - |
| NNQ27_RS13725 (NNQ27_13735) | 2832759..2834318 | - | 1560 | WP_275884811.1 | sensor domain-containing diguanylate cyclase | - |
| NNQ27_RS13730 (NNQ27_13740) | 2834611..2835330 | - | 720 | WP_275884812.1 | YnfC family lipoprotein | - |
| NNQ27_RS13740 (NNQ27_13750) | 2835755..2836552 | + | 798 | WP_038870946.1 | DgsA anti-repressor MtfA | - |
| NNQ27_RS13750 (NNQ27_13760) | 2836784..2837116 | - | 333 | WP_105635764.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NNQ27_RS13755 (NNQ27_13765) | 2837117..2837374 | - | 258 | WP_275884813.1 | antitoxin | Antitoxin |
| NNQ27_RS13760 (NNQ27_13770) | 2837906..2839225 | + | 1320 | WP_275886312.1 | shikimate transporter | - |
| NNQ27_RS13765 (NNQ27_13775) | 2839267..2840220 | - | 954 | WP_007716325.1 | HTH-type transcriptional regulator Cbl | - |
| NNQ27_RS13770 (NNQ27_13780) | 2840322..2841239 | - | 918 | WP_038870936.1 | nitrogen assimilation transcriptional regulator NAC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11935.71 Da Isoelectric Point: 8.1080
>T252365 WP_105635764.1 NZ_CP101595:c2837116-2836784 [Cronobacter dublinensis]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNHVTRLPIVLPVTSGGNFARTAGFAVSLDGAGTKTTGVIRCDQPRTI
DMEARHGIRLERLPDHVVNEVLARLEAILN
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNHVTRLPIVLPVTSGGNFARTAGFAVSLDGAGTKTTGVIRCDQPRTI
DMEARHGIRLERLPDHVVNEVLARLEAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|