Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1165959..1166578 | Replicon | chromosome |
| Accession | NZ_CP101595 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | K8B192 |
| Locus tag | NNQ27_RS05595 | Protein ID | WP_007713751.1 |
| Coordinates | 1165959..1166177 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | K8AHS7 |
| Locus tag | NNQ27_RS05600 | Protein ID | WP_007713750.1 |
| Coordinates | 1166204..1166578 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS05570 (NNQ27_05580) | 1162081..1163982 | + | 1902 | WP_007755675.1 | methyl-accepting chemotaxis protein | - |
| NNQ27_RS05575 (NNQ27_05585) | 1164125..1164385 | + | 261 | WP_007713755.1 | type B 50S ribosomal protein L31 | - |
| NNQ27_RS05580 (NNQ27_05590) | 1164389..1164529 | + | 141 | WP_275885827.1 | type B 50S ribosomal protein L36 | - |
| NNQ27_RS05585 (NNQ27_05595) | 1164559..1165068 | - | 510 | WP_007713753.1 | YlaC family protein | - |
| NNQ27_RS05590 (NNQ27_05600) | 1165188..1165739 | - | 552 | WP_038873740.1 | maltose O-acetyltransferase | - |
| NNQ27_RS05595 (NNQ27_05605) | 1165959..1166177 | - | 219 | WP_007713751.1 | HHA domain-containing protein | Toxin |
| NNQ27_RS05600 (NNQ27_05610) | 1166204..1166578 | - | 375 | WP_007713750.1 | Hha toxicity modulator TomB | Antitoxin |
| NNQ27_RS05605 (NNQ27_05615) | 1167098..1170247 | - | 3150 | WP_105630580.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NNQ27_RS05610 (NNQ27_05620) | 1170269..1171471 | - | 1203 | WP_032990671.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8624.06 Da Isoelectric Point: 9.4828
>T252360 WP_007713751.1 NZ_CP101595:c1166177-1165959 [Cronobacter dublinensis]
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14417.15 Da Isoelectric Point: 4.7269
>AT252360 WP_007713750.1 NZ_CP101595:c1166578-1166204 [Cronobacter dublinensis]
MDEYSPKRHDMAQLKFLCESLYHDCLATLGENQHGWVNDPTSAVNLQLNDLIEHIASFALNYKIKHEEDAALIEQLDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVNASRENPVSLSF
MDEYSPKRHDMAQLKFLCESLYHDCLATLGENQHGWVNDPTSAVNLQLNDLIEHIASFALNYKIKHEEDAALIEQLDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVNASRENPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|