Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 5029..5672 | Replicon | plasmid pA14-2 |
| Accession | NZ_CP101593 | ||
| Organism | Cronobacter dublinensis strain CFSA A14 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NMY27_RS22185 | Protein ID | WP_275877183.1 |
| Coordinates | 5256..5672 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NMY27_RS22180 | Protein ID | WP_275877182.1 |
| Coordinates | 5029..5259 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY27_RS22150 (NMY27_22110) | 234..1106 | + | 873 | WP_023897702.1 | RepB family plasmid replication initiator protein | - |
| NMY27_RS22155 (NMY27_22115) | 1275..1493 | + | 219 | WP_012815882.1 | hypothetical protein | - |
| NMY27_RS22160 (NMY27_22120) | 1486..2274 | - | 789 | WP_032968471.1 | site-specific integrase | - |
| NMY27_RS22165 (NMY27_22125) | 2264..3109 | - | 846 | WP_275877180.1 | hypothetical protein | - |
| NMY27_RS22170 (NMY27_22130) | 3351..4085 | - | 735 | WP_275877181.1 | hypothetical protein | - |
| NMY27_RS22175 (NMY27_22135) | 4155..4487 | - | 333 | WP_032968469.1 | hypothetical protein | - |
| NMY27_RS22180 (NMY27_22140) | 5029..5259 | + | 231 | WP_275877182.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NMY27_RS22185 (NMY27_22145) | 5256..5672 | + | 417 | WP_275877183.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMY27_RS22190 (NMY27_22150) | 5687..6445 | + | 759 | WP_275877184.1 | hypothetical protein | - |
| NMY27_RS22195 (NMY27_22155) | 7076..8242 | + | 1167 | WP_275877185.1 | hypothetical protein | - |
| NMY27_RS22200 (NMY27_22160) | 8426..10279 | - | 1854 | WP_275877186.1 | asparagine synthase (glutamine-hydrolyzing) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..42474 | 42474 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15200.73 Da Isoelectric Point: 8.7589
>T252358 WP_275877183.1 NZ_CP101593:5256-5672 [Cronobacter dublinensis]
MNKIYMLDTCICSFIMREQPEAVRKRLAQAVLRGHRIVISAITYSEMRFGATGPKASSRHIQLVNEFCTRLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLLLEDWVK
MNKIYMLDTCICSFIMREQPEAVRKRLAQAVLRGHRIVISAITYSEMRFGATGPKASSRHIQLVNEFCTRLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLLLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|