Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4210413..4210962 | Replicon | chromosome |
Accession | NZ_CP101591 | ||
Organism | Cronobacter dublinensis strain CFSA A14 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NMY27_RS20240 | Protein ID | WP_105630385.1 |
Coordinates | 4210413..4210721 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | NMY27_RS20245 | Protein ID | WP_199782193.1 |
Coordinates | 4210723..4210962 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY27_RS20220 (NMY27_20200) | 4205646..4206404 | - | 759 | WP_275876202.1 | SDR family oxidoreductase | - |
NMY27_RS20225 (NMY27_20205) | 4206523..4207422 | + | 900 | WP_275876203.1 | LysR family transcriptional regulator | - |
NMY27_RS20230 (NMY27_20210) | 4207475..4208509 | + | 1035 | WP_007753639.1 | inner membrane protein YhjD | - |
NMY27_RS20235 (NMY27_20215) | 4208784..4210112 | + | 1329 | WP_007753640.1 | MFS transporter | - |
NMY27_RS20240 (NMY27_20220) | 4210413..4210721 | - | 309 | WP_105630385.1 | CcdB family protein | Toxin |
NMY27_RS20245 (NMY27_20225) | 4210723..4210962 | - | 240 | WP_199782193.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NMY27_RS20250 (NMY27_20230) | 4211080..4213137 | - | 2058 | WP_275876204.1 | AsmA family protein | - |
NMY27_RS20255 (NMY27_20235) | 4213202..4213975 | - | 774 | WP_007753642.1 | cyclic-guanylate-specific phosphodiesterase | - |
NMY27_RS20260 (NMY27_20240) | 4214208..4215140 | + | 933 | WP_275876205.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11684.55 Da Isoelectric Point: 6.2118
>T252356 WP_105630385.1 NZ_CP101591:c4210721-4210413 [Cronobacter dublinensis]
MQYQIYRNTSTNKKYPYLIDVQSDLIDVLTTRVVIPLVPRFMAQKPLPERMCPVVEVDGDEYIVMTHEMASVGKSVLGEH
AASALPWRQHIKNAIDFVFDGF
MQYQIYRNTSTNKKYPYLIDVQSDLIDVLTTRVVIPLVPRFMAQKPLPERMCPVVEVDGDEYIVMTHEMASVGKSVLGEH
AASALPWRQHIKNAIDFVFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|