Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4144595..4145184 Replicon chromosome
Accession NZ_CP101591
Organism Cronobacter dublinensis strain CFSA A14

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NMY27_RS19910 Protein ID WP_007753220.1
Coordinates 4144595..4144963 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID K8BAC3
Locus tag NMY27_RS19915 Protein ID WP_007730583.1
Coordinates 4144963..4145184 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY27_RS19890 (NMY27_19870) 4140172..4141245 - 1074 WP_007753207.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NMY27_RS19895 (NMY27_19875) 4141247..4142092 - 846 WP_007753210.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMY27_RS19900 (NMY27_19880) 4142089..4142976 - 888 WP_007753215.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMY27_RS19905 (NMY27_19885) 4143105..4144424 - 1320 WP_032991278.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMY27_RS19910 (NMY27_19890) 4144595..4144963 - 369 WP_007753220.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMY27_RS19915 (NMY27_19895) 4144963..4145184 - 222 WP_007730583.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMY27_RS19920 (NMY27_19900) 4145317..4146030 - 714 WP_007730585.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMY27_RS19925 (NMY27_19905) 4146032..4146799 - 768 WP_007730587.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMY27_RS19930 (NMY27_19910) 4146796..4148076 - 1281 WP_007753233.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
NMY27_RS19935 (NMY27_19915) 4148073..4148999 - 927 WP_007730591.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMY27_RS19940 (NMY27_19920) 4149063..4149203 - 141 Protein_3879 amino acid-binding protein -
NMY27_RS19945 (NMY27_19925) 4149735..4150127 + 393 WP_038888875.1 aspartate 1-decarboxylase autocleavage activator PanM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4136164..4159300 23136


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13491.80 Da        Isoelectric Point: 7.4016

>T252355 WP_007753220.1 NZ_CP101591:c4144963-4144595 [Cronobacter dublinensis]
MTIHFISAEEIVRFHDRLLQVTPGVTGMPDPGRAEALMYRVLNKYEYEGVDDIWLLAAMHLLAIARGHIFNDGNKRTALF
ITLLFLKRNGIALAANPAFVEMTVNAAAGRLSLEAIAALLRS

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8168.20 Da        Isoelectric Point: 5.6746

>AT252355 WP_007730583.1 NZ_CP101591:c4145184-4144963 [Cronobacter dublinensis]
MRTMNYSEARQQLASALESATTGTPVTITRRGHKPAVIISAEEFERYQAAKLDAEFAEMMAVHGNEIRELADR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB K8BAC3

References