Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3575696..3576356 | Replicon | chromosome |
| Accession | NZ_CP101591 | ||
| Organism | Cronobacter dublinensis strain CFSA A14 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NMY27_RS17150 | Protein ID | WP_038869689.1 |
| Coordinates | 3575696..3576109 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | K8AL19 |
| Locus tag | NMY27_RS17155 | Protein ID | WP_007718966.1 |
| Coordinates | 3576090..3576356 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY27_RS17130 (NMY27_17110) | 3571682..3573415 | - | 1734 | WP_105633468.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NMY27_RS17135 (NMY27_17115) | 3573419..3574138 | - | 720 | WP_007752085.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NMY27_RS17140 (NMY27_17120) | 3574161..3575057 | - | 897 | WP_105640099.1 | site-specific tyrosine recombinase XerD | - |
| NMY27_RS17145 (NMY27_17125) | 3575159..3575680 | + | 522 | WP_007718971.1 | flavodoxin FldB | - |
| NMY27_RS17150 (NMY27_17130) | 3575696..3576109 | - | 414 | WP_038869689.1 | protein YgfX | Toxin |
| NMY27_RS17155 (NMY27_17135) | 3576090..3576356 | - | 267 | WP_007718966.1 | FAD assembly factor SdhE | Antitoxin |
| NMY27_RS17160 (NMY27_17140) | 3576634..3577623 | + | 990 | WP_275876027.1 | tRNA-modifying protein YgfZ | - |
| NMY27_RS17165 (NMY27_17145) | 3577753..3578406 | - | 654 | WP_105633465.1 | hemolysin III family protein | - |
| NMY27_RS17170 (NMY27_17150) | 3578569..3578883 | - | 315 | WP_275876028.1 | N(4)-acetylcytidine aminohydrolase | - |
| NMY27_RS17175 (NMY27_17155) | 3579061..3579789 | + | 729 | WP_275877059.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16259.21 Da Isoelectric Point: 11.5129
>T252354 WP_038869689.1 NZ_CP101591:c3576109-3575696 [Cronobacter dublinensis]
VVLWHSDLRVSWRSQWVSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFHGEVSLTADYQLRWQGV
DWEICATPWMLRSGMMLRLRHPKTTRSHHVWLASDSMTAKEWRDLRRLLLQQPVQGR
VVLWHSDLRVSWRSQWVSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFHGEVSLTADYQLRWQGV
DWEICATPWMLRSGMMLRLRHPKTTRSHHVWLASDSMTAKEWRDLRRLLLQQPVQGR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|