Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2758320..2758910 | Replicon | chromosome |
Accession | NZ_CP101591 | ||
Organism | Cronobacter dublinensis strain CFSA A14 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NMY27_RS13270 | Protein ID | WP_161590144.1 |
Coordinates | 2758320..2758652 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NMY27_RS13275 | Protein ID | WP_007749978.1 |
Coordinates | 2758653..2758910 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY27_RS13240 (NMY27_13230) | 2753413..2754318 | + | 906 | WP_275875780.1 | LysR family transcriptional regulator | - |
NMY27_RS13245 (NMY27_13235) | 2754293..2755852 | - | 1560 | WP_275875781.1 | sensor domain-containing diguanylate cyclase | - |
NMY27_RS13250 (NMY27_13240) | 2756146..2756865 | - | 720 | WP_275875782.1 | YnfC family lipoprotein | - |
NMY27_RS13260 (NMY27_13250) | 2757291..2758088 | + | 798 | WP_275875783.1 | DgsA anti-repressor MtfA | - |
NMY27_RS13270 (NMY27_13260) | 2758320..2758652 | - | 333 | WP_161590144.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NMY27_RS13275 (NMY27_13265) | 2758653..2758910 | - | 258 | WP_007749978.1 | programmed cell death antitoxin PemI | Antitoxin |
NMY27_RS13280 (NMY27_13270) | 2759441..2760760 | + | 1320 | WP_275877047.1 | shikimate transporter | - |
NMY27_RS13285 (NMY27_13275) | 2760802..2761755 | - | 954 | WP_007716325.1 | HTH-type transcriptional regulator Cbl | - |
NMY27_RS13290 (NMY27_13280) | 2761857..2762774 | - | 918 | WP_038870936.1 | nitrogen assimilation transcriptional regulator NAC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11949.74 Da Isoelectric Point: 8.1081
>T252352 WP_161590144.1 NZ_CP101591:c2758652-2758320 [Cronobacter dublinensis]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNHVTRLPIVLPVTSGGNFARTAGFAVSLEGAGTKTTGVIRCDQPRTI
DMEARHGIRLERLPDHVVNEVLARLEAILN
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNHVTRLPIVLPVTSGGNFARTAGFAVSLEGAGTKTTGVIRCDQPRTI
DMEARHGIRLERLPDHVVNEVLARLEAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|