Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1153181..1153800 | Replicon | chromosome |
| Accession | NZ_CP101591 | ||
| Organism | Cronobacter dublinensis strain CFSA A14 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V5U1U2 |
| Locus tag | NMY27_RS05530 | Protein ID | WP_007781479.1 |
| Coordinates | 1153181..1153399 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | K8AHS7 |
| Locus tag | NMY27_RS05535 | Protein ID | WP_007713750.1 |
| Coordinates | 1153426..1153800 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY27_RS05505 (NMY27_05500) | 1149299..1151200 | + | 1902 | WP_007755675.1 | methyl-accepting chemotaxis protein | - |
| NMY27_RS05510 (NMY27_05505) | 1151344..1151604 | + | 261 | WP_007713755.1 | type B 50S ribosomal protein L31 | - |
| NMY27_RS05515 (NMY27_05510) | 1151608..1151748 | + | 141 | WP_007713754.1 | type B 50S ribosomal protein L36 | - |
| NMY27_RS05520 (NMY27_05515) | 1151778..1152287 | - | 510 | WP_007713753.1 | YlaC family protein | - |
| NMY27_RS05525 (NMY27_05520) | 1152407..1152958 | - | 552 | WP_038873740.1 | maltose O-acetyltransferase | - |
| NMY27_RS05530 (NMY27_05525) | 1153181..1153399 | - | 219 | WP_007781479.1 | HHA domain-containing protein | Toxin |
| NMY27_RS05535 (NMY27_05530) | 1153426..1153800 | - | 375 | WP_007713750.1 | Hha toxicity modulator TomB | Antitoxin |
| NMY27_RS05540 (NMY27_05535) | 1154321..1157470 | - | 3150 | WP_007755683.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NMY27_RS05545 (NMY27_05540) | 1157492..1158694 | - | 1203 | WP_007713748.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8614.02 Da Isoelectric Point: 9.4828
>T252347 WP_007781479.1 NZ_CP101591:c1153399-1153181 [Cronobacter dublinensis]
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MTTKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14417.15 Da Isoelectric Point: 4.7269
>AT252347 WP_007713750.1 NZ_CP101591:c1153800-1153426 [Cronobacter dublinensis]
MDEYSPKRHDMAQLKFLCESLYHDCLATLGENQHGWVNDPTSAVNLQLNDLIEHIASFALNYKIKHEEDAALIEQLDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVNASRENPVSLSF
MDEYSPKRHDMAQLKFLCESLYHDCLATLGENQHGWVNDPTSAVNLQLNDLIEHIASFALNYKIKHEEDAALIEQLDEYL
DDTFMLFSNYGINAQDLQKWRKSGNRLFRCFVNASRENPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|