Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 1396..1870 | Replicon | plasmid p29_4 |
| Accession | NZ_CP101571 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP29 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | A0A8J3DT22 |
| Locus tag | NMY30_RS29280 | Protein ID | WP_004197762.1 |
| Coordinates | 1604..1870 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | S1EJF5 |
| Locus tag | NMY30_RS29275 | Protein ID | WP_000879771.1 |
| Coordinates | 1396..1620 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY30_RS29260 (NMY30_29240) | 1..510 | + | 510 | WP_032433972.1 | MbeB family mobilization protein | - |
| NMY30_RS29265 (NMY30_29245) | 517..729 | + | 213 | WP_021527181.1 | MbeD family mobilization/exclusion protein | - |
| NMY30_RS29270 | 1105..1233 | - | 129 | WP_000523570.1 | hypothetical protein | - |
| NMY30_RS29275 (NMY30_29250) | 1396..1620 | + | 225 | WP_000879771.1 | DUF6290 family protein | Antitoxin |
| NMY30_RS29280 (NMY30_29255) | 1604..1870 | + | 267 | WP_004197762.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMY30_RS29285 (NMY30_29260) | 1940..2290 | - | 351 | WP_004197756.1 | hypothetical protein | - |
| NMY30_RS29290 (NMY30_29265) | 2356..2901 | - | 546 | WP_023317533.1 | hypothetical protein | - |
| NMY30_RS29295 (NMY30_29270) | 2927..3253 | - | 327 | WP_050516389.1 | hypothetical protein | - |
| NMY30_RS29300 (NMY30_29275) | 4409..4585 | + | 177 | WP_004197757.1 | hypothetical protein | - |
| NMY30_RS29305 (NMY30_29280) | 4575..4919 | + | 345 | WP_062955149.1 | MobC family plasmid mobilization relaxosome protein | - |
| NMY30_RS29310 (NMY30_29285) | 5101..5346 | - | 246 | WP_032433971.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..5596 | 5596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10342.96 Da Isoelectric Point: 9.8727
>T252345 WP_004197762.1 NZ_CP101571:1604-1870 [Klebsiella pneumoniae subsp. pneumoniae]
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|